[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99687.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  134/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->148 1t62B PDBj 6e-22 35.3 %
:RPS:SCOP  7->149 1t62A  b.122.1.4 * 5e-21 34.3 %
:HMM:SCOP  2->149 1t62A_ b.122.1.4 * 1.6e-51 41.5 %
:RPS:PFM   40->147 PF04266 * ASCH 1e-10 45.6 %
:HMM:PFM   29->148 PF04266 * ASCH 1.3e-26 38.8 98/104  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99687.1 GT:GENE ABD99687.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(902109..902558) GB:FROM 902109 GB:TO 902558 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99687.1 GB:DB_XREF GI:90821048 LENGTH 149 SQ:AASEQ MNCSLIEKFWADFCNNHGISKSSHYEAYSFGDPESADYIADLVKNGIKTATSSALELYEENERIPQVGDYNVILDSQNLPICVTQTKVVEIVPFNQIMVEHAYHEGEGNRSYEYWHNAHVKFFNAEFKSANKVFTDSSPIVCEVFELIK GT:EXON 1|1-149:0| BL:PDB:NREP 1 BL:PDB:REP 6->148|1t62B|6e-22|35.3|139/163| RP:PFM:NREP 1 RP:PFM:REP 40->147|PF04266|1e-10|45.6|90/102|ASCH| HM:PFM:NREP 1 HM:PFM:REP 29->148|PF04266|1.3e-26|38.8|98/104|ASCH| RP:SCP:NREP 1 RP:SCP:REP 7->149|1t62A|5e-21|34.3|137/153|b.122.1.4| HM:SCP:REP 2->149|1t62A_|1.6e-51|41.5|147/166|b.122.1.4|1/1|PUA domain-like| OP:NHOMO 143 OP:NHOMOORG 134 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------11-----------------11------11------------1------------11-----------------------------------------1-----------------------------------------------------------11-1---1---1--1-1--111111-----------------1---1111-11--11122--22111--1111--111-111111111111111-------------111---111--1-1--------1-1---------------1----------------------------------1------------------------------------------------11------------------------------------------------------------------------1---------------------------1-------------------------------------------------------------------------------------------------------------------------------------111--1---1--1-111-1--1--1111111------13111---1-111111111-1-112---------1111111-1111-----------------1-------------------------------------------------------131-----1111-------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 93.3 SQ:SECSTR #####HHHHHHHHHHHHTcccccc#EEEEcccHHHHHHHHHHHHTTcccEEEEEHHHHHTTcccccTTcEEEEEcTTccEEEEEEEEEEEEEEGGGccHHHHHHTc###ccHHHHHHHHHHHHHHHHGGGcccccTTcEEEEEEEEEE# DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHHcccEEEEccHHHHHHccccccccccEEEEEcccccEEEEEEEEEEEEEEcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEc //