[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99691.1
DDBJ      :             ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  103/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:402 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 176->347 YHAP_BACSU 2e-25 35.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99691.1 GT:GENE ABD99691.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(905913..907121) GB:FROM 905913 GB:TO 907121 GB:DIRECTION - GB:PRODUCT ABC transporter, permease protein GB:NOTE COG1668 [CP] ABC-type Na+ efflux pump, permease component GB:PROTEIN_ID ABD99691.1 GB:DB_XREF GI:90821052 LENGTH 402 SQ:AASEQ MRLLHKLLLVAKETYIRQVKSWSFLFLVLSPFIFIGLSATISYFGAKMTPDDQIAIVSTDKTIQSQLKHHDTFTWKYKSVEDAKKAMKDDKIVGYVYIKSDSQKIAANYYGNDEMSSTDEVKIRQILQSKQATLNIVNAGLDKQQLQQLSIQPQYKKHIAKKAVDKKTVQSISYMILSFLMYIVILTYAATTAQEIAAEKGTKIMEVIFSSMSATKYFYGKILGILGVILTHTGIYLLGGIAIYPFIINLDMVSKFKDMIGDILLNLVSVNLIYVVLGIIIYTILAAFFGALVVRVEDTSKAIQPITILIIASFLSSMVFINNPSSMIVKVLSYVPFLSSFFMPIRVIDNSVSIIEISISLAILFATTALMTSYISKIYFGLILQSDDVGIWKNFRRGLKFK GT:EXON 1|1-402:0| BL:SWS:NREP 1 BL:SWS:REP 176->347|YHAP_BACSU|2e-25|35.3|167/419| TM:NTM 7 TM:REGION 23->45| TM:REGION 170->192| TM:REGION 226->248| TM:REGION 267->289| TM:REGION 301->323| TM:REGION 325->347| TM:REGION 351->373| SEG 141->154|ldkqqlqqlsiqpq| SEG 156->167|kkhiakkavdkk| SEG 348->363|idnsvsiieisislai| OP:NHOMO 112 OP:NHOMOORG 103 OP:PATTERN -------------------------------------------------------------------- 11---------1-------------------------------1-------------------------------------------------------1--1--------------------------------------11-------------------------------------------------111111111112112221111-112111111-1111111-1-111111111111111---1111-22--1-111--2211-11-111----------11111111111----------------------1---------------1----1111--1--1--------------------1---11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-90,116-120,142-142,144-145,148-148| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEEEccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHccc //