[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99693.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   131->178 1vkcA PDBj 3e-04 39.6 %
:RPS:PDB   3->175 1b6bA PDBj 1e-10 20.9 %
:RPS:SCOP  3->175 1b6bA  d.108.1.1 * 5e-11 20.9 %
:HMM:SCOP  1->175 2b5gA1 d.108.1.1 * 2.3e-20 25.0 %
:HMM:PFM   110->172 PF00583 * Acetyltransf_1 9.5e-12 31.0 58/83  
:BLT:SWISS 119->180 Y1207_METJA 4e-04 32.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99693.1 GT:GENE ABD99693.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(908093..908698) GB:FROM 908093 GB:TO 908698 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD99693.1 GB:DB_XREF GI:90821054 LENGTH 201 SQ:AASEQ MIKIRPLNESDEGDIAQILNKTWNFDGENDELLESRMYFLECMTNASYARVATVDGKVAGVLIAANLQEEHRNWNVIMRSIWLKMKQFFIPQEEVAQNWEGEEQILQTLEEKLPKDYDAELNLFVVSPEFRGYGIGSKLYRQFEIYLKKQHLKSFFLHTDTGCAYKFYEHKGLKRKAMKKSSCFYAIKDHKPVTFFIYGNV GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 119->180|Y1207_METJA|4e-04|32.3|62/100| BL:PDB:NREP 1 BL:PDB:REP 131->178|1vkcA|3e-04|39.6|48/149| RP:PDB:NREP 1 RP:PDB:REP 3->175|1b6bA|1e-10|20.9|139/168| HM:PFM:NREP 1 HM:PFM:REP 110->172|PF00583|9.5e-12|31.0|58/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 3->175|1b6bA|5e-11|20.9|139/168|d.108.1.1| HM:SCP:REP 1->175|2b5gA1|2.3e-20|25.0|132/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 16 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------12221111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 99.0 SQ:SECSTR cEEEEcccHHHHHHHHTccccccccccccccccTTTTTHHHHcGGGEEEEEEEETTEEEEEEEEEEEEccccccEEEEEEEEEcTETcccHHHHEEEEEccccccTGGGGcccTTccEEEEEEEEEGGGcTTccHHHHHHHHHHHHHHTcTTccEEEEEEcGGGHHHHHTTTcEEEEEEEccccccccHHcHHHHHHHH## DISOP:02AL 1-1| PSIPRED cEEEEEccccHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHccccEEEEEEccEEEEEEEccccccccccccHHccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHcccEEEEEEHHHHcccccccccEEEEEEEcc //