[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99694.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:46 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->43 PF07219 * HemY_N 0.00039 22.9 35/134  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99694.1 GT:GENE ABD99694.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 908870..909010 GB:FROM 908870 GB:TO 909010 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99694.1 GB:DB_XREF GI:90821055 LENGTH 46 SQ:AASEQ MLLNLLGFVLLLMTSVVLGILVWNTRINQPSQVTVRIKDNNYDSKK GT:EXON 1|1-46:0| TM:NTM 1 TM:REGION 3->25| SEG 2->12|llnllgfvlll| HM:PFM:NREP 1 HM:PFM:REP 9->43|PF07219|0.00039|22.9|35/134|HemY_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 38-47| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccc //