[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99695.1
DDBJ      :             DNA-binding protein HU
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  824/915 : Eukaryota  10/199 : Viruses  2/175   --->[See Alignment]
a.55.1
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->91 1hueA PDBj 3e-37 80.9 %
:RPS:PDB   3->91 3c4iB PDBj 2e-26 46.1 %
:RPS:SCOP  3->69 1b8zA  a.55.1.1 * 1e-17 45.5 %
:HMM:SCOP  2->91 1exeA_ a.55.1.1 * 3.5e-33 65.6 %
:RPS:PFM   4->91 PF00216 * Bac_DNA_binding 2e-21 68.2 %
:HMM:PFM   3->91 PF00216 * Bac_DNA_binding 5.1e-41 64.0 89/90  
:BLT:SWISS 3->91 DBH_BACST 9e-37 80.9 %
:PROS 47->66|PS00045|HISTONE_LIKE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99695.1 GT:GENE ABD99695.1 GT:PRODUCT DNA-binding protein HU GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(909069..909344) GB:FROM 909069 GB:TO 909344 GB:DIRECTION - GB:PRODUCT DNA-binding protein HU GB:NOTE COG0776 [L] Bacterial nucleoid DNA-binding protein GB:PROTEIN_ID ABD99695.1 GB:DB_XREF GI:90821056 LENGTH 91 SQ:AASEQ MANKAALIERVAEKTGLTKKDATVAVDAVFETIQDALVDGEKVQLIGFGNFEVRERAARKGRNPQTGEEIEIPASKVPAFKPGKSLKDAVK GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 3->91|DBH_BACST|9e-37|80.9|89/90| PROS 47->66|PS00045|HISTONE_LIKE|PDOC00044| BL:PDB:NREP 1 BL:PDB:REP 3->91|1hueA|3e-37|80.9|89/90| RP:PDB:NREP 1 RP:PDB:REP 3->91|3c4iB|2e-26|46.1|89/97| RP:PFM:NREP 1 RP:PFM:REP 4->91|PF00216|2e-21|68.2|88/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 3->91|PF00216|5.1e-41|64.0|89/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 3->69|1b8zA|1e-17|45.5|66/67|a.55.1.1| HM:SCP:REP 2->91|1exeA_|3.5e-33|65.6|90/99|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 2141 OP:NHOMOORG 839 OP:PATTERN ------------------------------1-------------------------------11---- 332-2---------11111-11111111111111111111111151-1111-1211111112112-121211111111----1223234435-422---12222222111---------------2232222242211111---2173112212122111111111321411111111111113211111-311333333333344344221112334111111111111112-1111111111111111111111211211111111111211112311111111111111111111111-111111111111111111111211111111111111211111111-1111111111112211111112122131644333333424233333333333333333333-2242343443416557333444333334322235333235555555554334843----------111111111111111----1346432322233353343333335632333334544543365543343335343336464454333433333343845444247454566154587554B3323425411--111111-11111111112111754541445335455555454555445444441-3434331233344444444444444244-44444444444444444444444444444444444444444444444444451444444444444--6333333333343443333333333333333333333333364555543554444444441111111113644444444445443333333333333333F-------11111111--113111---21------11--1----12111111112-2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2----111--1111--------1------ ---------------------------1--------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 89 STR:RPRED 97.8 SQ:SECSTR ##cHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHH DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEccEEEEEEEEcccccccccccccEEEEccccEEEEEccHHHHHHHc //