[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99700.1
DDBJ      :             D-alanine-poly(phosphoribitol)ligase subunit 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->73 1dv5A PDBj 9e-26 71.2 %
:RPS:PDB   1->74 1dv5A PDBj 4e-06 70.3 %
:RPS:SCOP  1->73 1dv5A  a.28.1.3 * 4e-18 71.2 %
:HMM:SCOP  1->76 1dv5A_ a.28.1.3 * 4.7e-14 30.3 %
:HMM:PFM   3->70 PF00550 * PP-binding 1e-14 39.7 63/67  
:BLT:SWISS 1->73 DLTC_LACRH 3e-25 71.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99700.1 GT:GENE ABD99700.1 GT:PRODUCT D-alanine-poly(phosphoribitol)ligase subunit 2 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(914084..914311) GB:FROM 914084 GB:TO 914311 GB:DIRECTION - GB:PRODUCT D-alanine-poly(phosphoribitol)ligase subunit 2 GB:NOTE COG0236 [IQ] Acyl carrier protein GB:PROTEIN_ID ABD99700.1 GB:DB_XREF GI:90821061 LENGTH 75 SQ:AASEQ MKDTVLDILEDLTGSDEVKKDLDVNLFETGLLDSMATVQLLLELQTQLGVDVPVSEFERSEWDTPNKIIAKVENN GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 1->73|DLTC_LACRH|3e-25|71.2|73/81| SEG 39->48|qlllelqtql| BL:PDB:NREP 1 BL:PDB:REP 1->73|1dv5A|9e-26|71.2|73/80| RP:PDB:NREP 1 RP:PDB:REP 1->74|1dv5A|4e-06|70.3|74/80| HM:PFM:NREP 1 HM:PFM:REP 3->70|PF00550|1e-14|39.7|63/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 1->73|1dv5A|4e-18|71.2|73/80|a.28.1.3| HM:SCP:REP 1->76|1dv5A_|4.7e-14|30.3|76/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 90 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1111111121111111--1111111---1------------111111111111111111111111111111221111111111111111-111----------------------------11---111-----1-------1-1-1----------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 98.7 SQ:SECSTR HHHHHHHHHHHHHTcccTTTcccccccTTcccccHHHHHHHHHHTTTcccccccccccTTTTTcHHHHHHHHHT# DISOP:02AL 1-1,74-76| PSIPRED cHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccHHHHHHHHHcc //