[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99713.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.6
:346 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  202->315 1b54A  c.1.6.2 * 6e-04 13.6 %
:HMM:PFM   39->79 PF09382 * RQC 0.00025 31.7 41/106  
:HMM:PFM   189->228 PF01195 * Pept_tRNA_hydro 0.0009 32.5 40/184  
:BLT:SWISS 12->298 YPBB_BACSU 4e-13 22.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99713.1 GT:GENE ABD99713.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(924864..925904) GB:FROM 924864 GB:TO 925904 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99713.1 GB:DB_XREF GI:90821074 LENGTH 346 SQ:AASEQ MVELRLLDFFSIDQPRRQAVLRQILKNKVTSSSIYWGLRYNYLSYLNVFPELDEKNYDRAIAQLIEENYLSKKDNKLLLTIKGKNALDEFKQQHYFIDKPQLFNKYDLKLWKEILRLMIQVLSELSFENRQYYVVSQNLKAQFYIKKWLYQEKREVLIPQFKEYLLDFLGSQPKDKSDIFMNSFVGHGLPGYTIEQLSEFTGLATADIQIVIDDLSLKFADYLNQKGGNYSKIVNLVSRSQGLPTSVEETYTLLQKGFTVEKIKQIRRLKESTIQEHLIIASILSNNFDYHQVLTSEDHRILQNIYSDDNLDDWKYQDLELSGHQMPFYKFRIYQVQRSKLNNDRT GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 12->298|YPBB_BACSU|4e-13|22.8|281/352| HM:PFM:NREP 2 HM:PFM:REP 39->79|PF09382|0.00025|31.7|41/106|RQC| HM:PFM:REP 189->228|PF01195|0.0009|32.5|40/184|Pept_tRNA_hydro| RP:SCP:NREP 1 RP:SCP:REP 202->315|1b54A|6e-04|13.6|110/230|c.1.6.2| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----11111111111111111111-1-1--111111--1-------------------1-1-11-1---111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 342-347| PSIPRED ccHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHcHHHHHcccccccHHHHHHHHHHHHHcccEEEEccEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHccccccccHHHHccccccHHHHHHHHHHHHHcccccc //