[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99717.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:514 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->100 PF06570 * DUF1129 0.00013 17.9 78/205  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99717.1 GT:GENE ABD99717.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(929989..931533) GB:FROM 929989 GB:TO 931533 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99717.1 GB:DB_XREF GI:90821078 LENGTH 514 SQ:AASEQ MNFFNYLFKSSRSIINILFTIFIGLTFYFTLTSSNLLLNSQTTTWVTMVMLLGLVGIIIIMITDNFVKRFARSVYQSGWLGMLVLGILLLIWQIFFIVATHPAIGFDVNMLHQAWINPNQAKVRGYFSQNYNNLPILLLQNWILTKFHSTSWLVIDSVTLFLVNLSALINIVTMYLVSKDKVRLLWYLQIIFLAFFPMIIIPYTDTWVLPSVSLILLGFVGMSSHSFNLIYRILFSVMAGVATVITYYIKPSGIIPAIAFIIVGIVYLCNIPGKKQLLRAFCLLVFLFGSGAITFVLGQNIISNQKYVSIDKSLEIPSIHFVNMGMSGTTGAYNPHDALMMAKLPKKQDKIAYSKKMIRKRLKQRGFGGYISFLIRKQGYNTADGTFGWLGEGTFIFTKIPASNWKWWAQTFTYPDGKNVSVFRFISQLIWISLVGILFFGWKYHDLVSDGLRLSLIGGFLFLLIFEGGRSRYLIQFLPSIIILIPIVWQSSKETIAKILLATGLKKMEVSQNA GT:EXON 1|1-514:0| TM:NTM 12 TM:REGION 9->31| TM:REGION 46->67| TM:REGION 83->105| TM:REGION 152->174| TM:REGION 183->204| TM:REGION 206->223| TM:REGION 229->250| TM:REGION 252->273| TM:REGION 279->301| TM:REGION 420->442| TM:REGION 447->469| TM:REGION 479->501| SEG 25->44|ltfyftltssnlllnsqttt| SEG 48->62|mvmllglvgiiiimi| SEG 78->92|gwlgmlvlgillliw| SEG 253->266|giipaiafiivgiv| SEG 451->470|glrlsliggflfllifeggr| HM:PFM:NREP 1 HM:PFM:REP 16->100|PF06570|0.00013|17.9|78/205|DUF1129| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------1---1------11-----1-111-11-------1--------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 510-515| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccHHHHHHcccccccccccHHHHHHHHHcccHHHHHHccHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //