[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99731.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->64 2rirE PDBj 4e-04 37.1 %
:BLT:SWISS 30->64 SP5FA_BACSU 4e-04 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99731.1 GT:GENE ABD99731.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(951368..951577) GB:FROM 951368 GB:TO 951577 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99731.1 GB:DB_XREF GI:90821092 LENGTH 69 SQ:AASEQ MDVMDVFNRKWCIVTMKDGRKERLYVVDVDYETFGYDMIIYNYTGSDSYGIDDIPFSKIDEIVIDGDYL GT:EXON 1|1-69:0| BL:SWS:NREP 1 BL:SWS:REP 30->64|SP5FA_BACSU|4e-04|37.1|35/297| BL:PDB:NREP 1 BL:PDB:REP 30->64|2rirE|4e-04|37.1|35/292| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 35 STR:RPRED 50.7 SQ:SECSTR #############################EEEEEccTTcccccTTcEEEcTTTccTTTccEEEc##### DISOP:02AL 1-1| PSIPRED ccHHHHcccEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEcccccccccccHHHEEEEEEccccc //