[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99735.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99735.1 GT:GENE ABD99735.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(953933..954160) GB:FROM 953933 GB:TO 954160 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99735.1 GB:DB_XREF GI:90821096 LENGTH 75 SQ:AASEQ MHSLFFHNFCILSESFCVCNLKLIILIAKFSIIIDYQIVLFINQHRIIFYSRNCYYAIIITYSFIDYLMSLTITK GT:EXON 1|1-75:0| TM:NTM 2 TM:REGION 12->34| TM:REGION 52->74| SEG 21->34|lkliiliakfsiii| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,75-76| PSIPRED cccEEEEEEEEEEccEEEEEEEEEEEEEEEEEEEEEEEEEEEEccEEEEEEccEEEEEEEEHHHHHHHEEEEEEc //