[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99736.1
DDBJ      :             Zwittermicin A resistance protein zmaR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:252 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->249 3g3sA PDBj 2e-61 49.8 %
:RPS:PDB   162->248 3c26A PDBj 1e-07 14.9 %
:RPS:SCOP  165->240 1yr0A1  d.108.1.1 * 3e-08 25.0 %
:HMM:SCOP  132->250 1p0hA_ d.108.1.1 * 6.1e-09 18.5 %
:HMM:PFM   171->240 PF00583 * Acetyltransf_1 1.4e-07 15.7 70/83  
:BLT:SWISS 1->248 YDFB_BACSU 2e-12 24.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99736.1 GT:GENE ABD99736.1 GT:PRODUCT Zwittermicin A resistance protein zmaR GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 954140..954898 GB:FROM 954140 GB:TO 954898 GB:DIRECTION + GB:PRODUCT Zwittermicin A resistance protein zmaR GB:PROTEIN_ID ABD99736.1 GB:DB_XREF GI:90821097 LENGTH 252 SQ:AASEQ MKEQTMQKVHSLFTGWNQTIIWSCLDGTMGQIIVDDDSNPQSALAILGINSAFAFFAGKPNLNLITTAVDACSDLIMVPQNTEWANMIEKYCGEQVRKFTRYATLKDTKFDIPRLQLNIEKLPPEFQIHSIDANLYDQCLQKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSFSSYQNGIEIEVATHPDFQRRGLATIACSQLIITCLDQSLYPSWDAHTEISLHLAQKLGYQFAYKYLAYEIEE GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 1->248|YDFB_BACSU|2e-12|24.2|236/100| BL:PDB:NREP 1 BL:PDB:REP 7->249|3g3sA|2e-61|49.8|239/245| RP:PDB:NREP 1 RP:PDB:REP 162->248|3c26A|1e-07|14.9|87/250| HM:PFM:NREP 1 HM:PFM:REP 171->240|PF00583|1.4e-07|15.7|70/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 165->240|1yr0A1|3e-08|25.0|76/163|d.108.1.1| HM:SCP:REP 132->250|1p0hA_|6.1e-09|18.5|119/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 35 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--12--11-111-----11-2---2-------------------------------------------------1-------111----1---11---11-1--------------111---111------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 96.0 SQ:SECSTR ######HHHHHHHcccccHHHHHHHHcc#cEEEEcccccccEEEEEEEcccEEEEEEEcccHHHHHHHTT##ccEEEEEccHHHHHHHHHHHGGGEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccTTccTTcTTcEEEEEETTEEEEEEEEEcTTccEEEEEEEcGGGTTccHHHHHHHHHHHcTTccEEEEEEETTcHHHHHHHHHHTcEEEEEEEEETTc# DISOP:02AL 1-6,8-10| PSIPRED ccHHHHHHHHHHHcccccEEEEEEEEccEEEEEEcccccccEEEEEEEccccEEEEcccccccHHHHHHHccccEEEEEcccHHHHHHHHHHcccHHcccccccccccccHHHHHHHHHHHcccccEEEEccHHHcccccHHHHHHHHHHccccHHHHHHccccEEEEEccEEEEEEEEEEEEccEEEEEEEEcHHHccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccEEEEEEcc //