[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99737.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->27 PF10623 * PilI 0.0007 29.2 24/83  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99737.1 GT:GENE ABD99737.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 955042..955167 GB:FROM 955042 GB:TO 955167 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99737.1 GB:DB_XREF GI:90821098 LENGTH 41 SQ:AASEQ MSKRTDAKILIIIFKLLDESLIVFCFKWRRKLHYFLAKAES GT:EXON 1|1-41:0| TM:NTM 1 TM:REGION 7->27| HM:PFM:NREP 1 HM:PFM:REP 4->27|PF10623|0.0007|29.2|24/83|PilI| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,40-42| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //