[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99740.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y930_LACS1   RecName: Full=UPF0398 protein LSL_0930;

Homologs  Archaea  0/68 : Bacteria  128/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.129.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->175 2nx2A PDBj 3e-37 37.0 %
:RPS:SCOP  3->175 2nx2A1  c.129.1.2 * 2e-11 37.0 %
:RPS:PFM   1->165 PF06908 * DUF1273 1e-41 49.7 %
:HMM:PFM   2->175 PF06908 * DUF1273 1.4e-78 57.5 174/177  
:BLT:SWISS 1->183 Y930_LACS1 e-107 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99740.1 GT:GENE ABD99740.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(958535..959086) GB:FROM 958535 GB:TO 959086 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99740.1 GB:DB_XREF GI:90821101 LENGTH 183 SQ:AASEQ MNLWVTGYRSYELGVFNSKDKKVEVIKYALQKKILEKLDEGLEWVITGAQMGIEQWTCEVVAEMKKEYPELKLAIMMPYSEFAGNWNEANQESFSIRCSLADFVGEVSKEKYKSPMQLKNYQNFMLDHTDQAMLIYDPEHEGKTKYDYEMIKKYSEQEDYSYDLVDMYQLQEFAEMYQEKDSF GT:EXON 1|1-183:0| SW:ID Y930_LACS1 SW:DE RecName: Full=UPF0398 protein LSL_0930; SW:GN OrderedLocusNames=LSL_0930; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->183|Y930_LACS1|e-107|100.0|183/183| BL:PDB:NREP 1 BL:PDB:REP 3->175|2nx2A|3e-37|37.0|173/178| RP:PFM:NREP 1 RP:PFM:REP 1->165|PF06908|1e-41|49.7|161/169|DUF1273| HM:PFM:NREP 1 HM:PFM:REP 2->175|PF06908|1.4e-78|57.5|174/177|DUF1273| RP:SCP:NREP 1 RP:SCP:REP 3->175|2nx2A1|2e-11|37.0|173/177|c.129.1.2| OP:NHOMO 128 OP:NHOMOORG 128 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 94.5 SQ:SECSTR ##EEEEEccHHHHTccccccHHHHHHHHHHHHHHHHHHTTTccEEEEcccTTHHHHHHHHHHTTTTTcTTcEEEEEEccccTTTTccHHHHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHccEEEEEccTTTccTTHHHHHHHHHHHHHHcccEEEEcHHHHHHHHH######## DISOP:02AL 180-184| PSIPRED cEEEEEcccHHHccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEcccccHHcccHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHHccc //