[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99749.1
DDBJ      :             Segregation and condensation protein ScpB
Swiss-Prot:SCPB_LACS1   RecName: Full=Segregation and condensation protein B;

Homologs  Archaea  5/68 : Bacteria  525/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->158 1t6sA PDBj 6e-19 38.7 %
:RPS:PDB   2->46 3bp8A PDBj 1e-04 6.7 %
:RPS:SCOP  8->80 1t6sA1  a.4.5.60 * 6e-09 33.8 %
:RPS:SCOP  87->158 1t6sA2  a.4.5.60 * 1e-08 44.4 %
:HMM:SCOP  1->81 1t6sA1 a.4.5.60 * 4.1e-12 36.7 %
:HMM:SCOP  82->158 1t6sA2 a.4.5.60 * 9.1e-25 55.8 %
:RPS:PFM   8->160 PF04079 * DUF387 8e-30 46.4 %
:HMM:PFM   6->167 PF04079 * DUF387 1.7e-55 50.9 159/159  
:BLT:SWISS 1->196 SCPB_LACS1 8e-93 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99749.1 GT:GENE ABD99749.1 GT:PRODUCT Segregation and condensation protein ScpB GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(968156..968746) GB:FROM 968156 GB:TO 968746 GB:DIRECTION - GB:PRODUCT Segregation and condensation protein ScpB GB:NOTE COG1386 [K] Predicted transcriptional regulator containing the HTH domain GB:PROTEIN_ID ABD99749.1 GB:DB_XREF GI:90821110 LENGTH 196 SQ:AASEQ MLSNQAKIESLLFISGNEGITLTELSQITGILKPALHEQLDKLADKYKQDRSSSLQLIHAEERYKLVTKPALAELVKKYLNSNNITELTGAALETLAIIAYKQPITRIGVDEIRGVQSSSMIQRLQLLELIKENGRLDAPGRPILYVTTDKFLDYFGLESLDQLPELDEEKQEDEEMDLMTLFEQTTGSTEDEEEE GT:EXON 1|1-196:0| SW:ID SCPB_LACS1 SW:DE RecName: Full=Segregation and condensation protein B; SW:GN Name=scpB; OrderedLocusNames=LSL_0939; SW:KW Cell cycle; Cell division; Chromosome partition; Complete proteome;Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->196|SCPB_LACS1|8e-93|100.0|196/196| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0007059|"GO:chromosome segregation"|Chromosome partition| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 161->180|ldqlpeldeekqedeemdlm| BL:PDB:NREP 1 BL:PDB:REP 15->158|1t6sA|6e-19|38.7|142/162| RP:PDB:NREP 1 RP:PDB:REP 2->46|3bp8A|1e-04|6.7|45/381| RP:PFM:NREP 1 RP:PFM:REP 8->160|PF04079|8e-30|46.4|151/160|DUF387| HM:PFM:NREP 1 HM:PFM:REP 6->167|PF04079|1.7e-55|50.9|159/159|DUF387| RP:SCP:NREP 2 RP:SCP:REP 8->80|1t6sA1|6e-09|33.8|71/85|a.4.5.60| RP:SCP:REP 87->158|1t6sA2|1e-08|44.4|72/77|a.4.5.60| HM:SCP:REP 1->81|1t6sA1|4.1e-12|36.7|79/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->158|1t6sA2|9.1e-25|55.8|77/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 536 OP:NHOMOORG 531 OP:PATTERN -----------------------1--------------------------11--1---1--------- 111-111111111111-11-111111111111111111111111-1--111-1111-1--111--111111----11111111----------------------11-1---------------111111111-1111111---11-1----------------1-----1-------------11111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111-11111---------1---------------------------------3--------------1111-11111111211111111111111111-----------------------------11111-1111111111111111111111111111111111111111111-1111111111111111-111111111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--111-1--------------------------------------------------------------------------------------------1111111111111-----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-----1-1111111111111111111-1-1-1-1-1-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 80.1 SQ:SECSTR ccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHTHH#HHHTccEEEEETTEEEEEEcGGGHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHTcccccHHHHHHHTTcEEEEEEcccTTccEEEEEcHHHHHHTTc###################################### DISOP:02AL 1-3,168-173,186-197| PSIPRED cccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEcHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHcccEEEccccccccccEEEEEcHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHcc //