[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99761.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:300 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   120->165 PF00262 * Calreticulin 0.00031 34.8 46/366  
:BLT:SWISS 20->112 PCKA_CAMLR 5e-04 35.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99761.1 GT:GENE ABD99761.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(978049..978951) GB:FROM 978049 GB:TO 978951 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99761.1 GB:DB_XREF GI:90821122 LENGTH 300 SQ:AASEQ MITVKLNYVFLFLSDPLDSRIPDVEYEKEYKTASKYFSVGLINQERLFEDNVVTTTYKISNDDIIIYRGWMLKPQLYDRLVTYVEKNGGQMFTNLSEYEYTHLIPNWVKDNSNHVKTKWTIDLSDKSIIKLLEEFNGAVTIKDFVKSRKYEWDDAFYIPDVSDTKNALRVIHNFINRQGSELIGGLVIRDFIELKNIGRHPKSHTPIFEEYRVFYIGNEPLVVINYWNDRKINLSTEDKKVIMNAPKEGKAKFYTIDFARKSNGKLVIMEMGDGQVSGLQGFDEQKFYDLLWENLPESRA GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 20->112|PCKA_CAMLR|5e-04|35.5|93/100| HM:PFM:NREP 1 HM:PFM:REP 120->165|PF00262|0.00031|34.8|46/366|Calreticulin| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------1------------------1----1--------------------------------------------------------------------------1-1------------------------------------------------------------------------------------1------------------------------------11-1-------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12-----------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,297-301| PSIPRED cEEEEEEEEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEHHHHHHcccEEEEcccccccEEEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccEEEEEccccccHHHccccEEEEEEEHHHccccccccccccccHHHHHHHHHHHHHHHHccccEEccEEHHHHHHHHHccccccccccccccEEEEEEccccEEEEEcccccccccccccHHHHHHHHHHccccEEEEEEEEccccEEEEEEEcccEEcccccccHHHHHHHHHHHcHHccc //