[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99762.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99762.1 GT:GENE ABD99762.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(978976..979209) GB:FROM 978976 GB:TO 979209 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99762.1 GB:DB_XREF GI:90821123 LENGTH 77 SQ:AASEQ MDLRPYWGKNVIVTDVDNIIYRGFVTAVTIPGDSDDNCYEIDLIRTKQYRDGYFTLTEYEIKSIELDPDKEDLCESK GT:EXON 1|1-77:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,71-72,75-78| PSIPRED cccccccccEEEEEEcccEEEEEEEEEEEEcccccccEEEEEEEEEEEccccEEEEEEEEEEEEEEcccHHHHHccc //