[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99767.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->81 PF03706 * UPF0104 5.4e-05 19.4 62/294  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99767.1 GT:GENE ABD99767.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(981374..981631) GB:FROM 981374 GB:TO 981631 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99767.1 GB:DB_XREF GI:90821128 LENGTH 85 SQ:AASEQ MNRVYEGIQFATVTITLSAVITLITLFVTPSVWQLMLLITGEVIVINAAYLIFVLVLLGLKNLLDYWEKNQNRFKSDKSKFKYLN GT:EXON 1|1-85:0| TM:NTM 2 TM:REGION 8->30| TM:REGION 39->61| SEG 51->64|lifvlvllglknll| HM:PFM:NREP 1 HM:PFM:REP 12->81|PF03706|5.4e-05|19.4|62/294|UPF0104| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,79-80| PSIPRED ccHHHccEEEEEEEHHHHHHHHHHHHHHcHHHHHHHHHHHccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccc //