[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99770.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->73 PF11148 * DUF2922 3e-04 33.8 %
:HMM:PFM   5->73 PF11148 * DUF2922 2e-23 37.3 67/69  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99770.1 GT:GENE ABD99770.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(982289..982522) GB:FROM 982289 GB:TO 982522 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99770.1 GB:DB_XREF GI:90821131 LENGTH 77 SQ:AASEQ MKVRALNLGFKAADGKHHTLKLNNVSTNLDEGKLREAMNKLVELDMFQDKFGTKLYAETVSAKYVDTETQTVFTVED GT:EXON 1|1-77:0| RP:PFM:NREP 1 RP:PFM:REP 4->73|PF11148|3e-04|33.8|68/69|DUF2922| HM:PFM:NREP 1 HM:PFM:REP 5->73|PF11148|2e-23|37.3|67/69|DUF2922| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,77-78| PSIPRED ccEEEEEEEEEcccccEEEEEcccHHccccHHHHHHHHHHHHHHHccccccccEEEEccccEEEEEEEEEEEEEEcc //