[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99774.1
DDBJ      :             Phosphohydrolase, MutT/nudix family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->184 3fcmB PDBj 1e-40 47.4 %
:RPS:PDB   44->183 2azwA PDBj 1e-10 12.5 %
:RPS:SCOP  44->183 2azwA1  d.113.1.1 * 5e-11 12.5 %
:HMM:SCOP  37->184 2fmlA2 d.113.1.6 * 9e-15 25.9 %
:HMM:PFM   45->167 PF00293 * NUDIX 1.6e-08 22.3 112/135  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99774.1 GT:GENE ABD99774.1 GT:PRODUCT Phosphohydrolase, MutT/nudix family protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 984492..985058 GB:FROM 984492 GB:TO 985058 GB:DIRECTION + GB:PRODUCT Phosphohydrolase, MutT/nudix family protein GB:NOTE COG0494 [LR] NTP pyrophosphohydrolases including oxidative damage repair enzymes GB:PROTEIN_ID ABD99774.1 GB:DB_XREF GI:90821135 LENGTH 188 SQ:AASEQ MNDLMSQLKSYIPFNEQEKQDKQLIIDQLANAKDIFTRKNKLAHFTVSAWIISHDKNKVLMAYHNIYQSWSWLGGHADGNSNLKQVILKEIQEESGLTDVKFLSDDIFSLEVLTVDGHEKRGEYVSSHLHLNITYLFEADTTMPLRIKPDENSQIAWLDLSSLDSKVSEVWFNQRIYHKLIEKVNLLY GT:EXON 1|1-188:0| BL:PDB:NREP 1 BL:PDB:REP 5->184|3fcmB|1e-40|47.4|173/179| RP:PDB:NREP 1 RP:PDB:REP 44->183|2azwA|1e-10|12.5|128/146| HM:PFM:NREP 1 HM:PFM:REP 45->167|PF00293|1.6e-08|22.3|112/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 44->183|2azwA1|5e-11|12.5|128/146|d.113.1.1| HM:SCP:REP 37->184|2fmlA2|9e-15|25.9|135/0|d.113.1.6|1/1|Nudix| OP:NHOMO 42 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11-------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1----111--------------------------------------11------1-1-------1-1-----1111----------------------------------------------------------------------------------------------------1-------------------------------11-111--11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------1111111112------------------------1------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 97.9 SQ:SECSTR ####HHHHccccEEEEccHHHHHHHHHHHcEEEEcTHTTcccEccEEEEEcEEGGEGTEEEEEEcTTccEEccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEEcEEccccccccEEEEEcHHHHHHHcccHHHHHHHHHHHHHcHHccc DISOP:02AL 1-1| PSIPRED ccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEccccEEEEEEEcccccccccccEEcccccHHHHHHHHHHHHHcccccEEcccccEEEEEEEEccccccccccccEEEEEEEEEEEEcccccccccccccccEEEEEHHHHHHcccccHHHHHHHHHHHHHHHHHc //