[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99779.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->127 PF07423 * DUF1510 8.8e-07 17.9 123/217  
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99779.1 GT:GENE ABD99779.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 988702..989271 GB:FROM 988702 GB:TO 989271 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99779.1 GB:DB_XREF GI:90821140 LENGTH 189 SQ:AASEQ MRKISIFVLSVLTLVTLGACSITSSSKSSNESLFSYKASSRKAESIKKAKKEAHDKAEAAKKKKHKKKKKKKESSSSSEQSSSVSSSVSESTDSSSVSSSDDTQDTSSNQQNTSQGNTTTYQAPASSYYYGGYTAPQGGGSGSGSGSGASTPTDSNPSPSDDGDANNDSGNSGNAGDNVPEQPTTAAEE GT:EXON 1|1-189:0| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 37->62| TM:NTM 1 TM:REGION 4->25| SEG 18->122|gacsitssskssneslfsykassrkaesikkakkeahdkaeaakkkkhkkkkkkkessssseqsssvsssvsestdsssvsssddtqdtssnqqntsqgntttyq| SEG 128->178|yyyggytapqgggsgsgsgsgastptdsnpspsddgdanndsgnsgnagdn| HM:PFM:NREP 1 HM:PFM:REP 4->127|PF07423|8.8e-07|17.9|123/217|DUF1510| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,24-119,136-190| PSIPRED ccEEEHHHHHHHHHHHHcccEEccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //