[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99784.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->58 PF07853 * DUF1648 1.7e-07 40.9 44/51  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99784.1 GT:GENE ABD99784.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(992368..992700) GB:FROM 992368 GB:TO 992700 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99784.1 GB:DB_XREF GI:90821145 LENGTH 110 SQ:AASEQ MKKFKFLIRSSYLFVLLEIFYYLRIAPQVIGTHFVSDNIPDSFGNKYQLFLWELLILIMGESIILIEKNWRVKNKLDNLPELLPREYRLLIVPVVIIIMAGFIMFQQISV GT:EXON 1|1-110:0| TM:NTM 3 TM:REGION 7->29| TM:REGION 47->69| TM:REGION 83->105| SEG 79->90|lpellpreyrll| HM:PFM:NREP 1 HM:PFM:REP 15->58|PF07853|1.7e-07|40.9|44/51|DUF1648| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccEEEEEEccccHHHHHHcHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc //