[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99788.1
DDBJ      :             UDP-glucuronate 4-epimerase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  821/915 : Eukaryota  162/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->351 1sb9A PDBj 2e-33 34.6 %
:RPS:PDB   9->353 1e7rA PDBj 4e-38 18.1 %
:RPS:SCOP  2->355 1sb8A  c.2.1.2 * 6e-66 33.3 %
:HMM:SCOP  1->360 1gy8A_ c.2.1.2 * 2.2e-79 32.6 %
:RPS:PFM   11->245 PF01370 * Epimerase 3e-37 39.6 %
:HMM:PFM   11->274 PF01370 * Epimerase 1.2e-54 36.5 233/238  
:BLT:SWISS 10->356 CAPI_STAAU 2e-91 51.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99788.1 GT:GENE ABD99788.1 GT:PRODUCT UDP-glucuronate 4-epimerase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(996533..997612) GB:FROM 996533 GB:TO 997612 GB:DIRECTION - GB:PRODUCT UDP-glucuronate 4-epimerase GB:NOTE COG0451 [MG] Nucleoside-diphosphate-sugar epimerases GB:PROTEIN_ID ABD99788.1 GB:DB_XREF GI:90821149 LENGTH 359 SQ:AASEQ MKKIDLTGKRILITGGAGFIGANLILSLLQTVKSVNILTVDNINDYYDVSLKEWRLQQIESEATQHEESKFEFIKGDISDVGLVNQIFADFKPDIVVNLAAQAGVRNSITNPDAYIKSNIIGFYNILEACRHSYDNENGVEHLVFASSSSIYGNGKEIPYKTDSNTDKPISLYAATKKSDEMLAHVYSHLFGIPITGLRFFTVYGPGGRPDMAYFKFTKKLINDEKIQIFNYGNCRRDFTYIDDVVEGVKRVMSGVPEKSEQDLEPAYRIYNIGNHHPENLMEFVKILQDELVRANVLPKDYDFEGHMELVPMQPGDVAVTYADISELEKDFNFKPDTRLRVGLRKFAEWYRDFYELGK GT:EXON 1|1-359:0| BL:SWS:NREP 1 BL:SWS:REP 10->356|CAPI_STAAU|2e-91|51.7|323/334| BL:PDB:NREP 1 BL:PDB:REP 2->351|1sb9A|2e-33|34.6|321/340| RP:PDB:NREP 1 RP:PDB:REP 9->353|1e7rA|4e-38|18.1|298/314| RP:PFM:NREP 1 RP:PFM:REP 11->245|PF01370|3e-37|39.6|212/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 11->274|PF01370|1.2e-54|36.5|233/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 2->355|1sb8A|6e-66|33.3|327/341|c.2.1.2| HM:SCP:REP 1->360|1gy8A_|2.2e-79|32.6|337/383|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4129 OP:NHOMOORG 1052 OP:PATTERN 11211-32444335322511134383337433365326141223836767565133322331343-15 6872622533412124344-412234444442223223252645-12121125551111153-1545636233333332322536774778515111--44447547885--------------333423765434ACC7A-11A57657666123365435424466575453522566436323112241355554688555767973655545593523343111211692222122222222224---25111442331345114335223232223223333333442422432411111111111112113331112331946666777455514433425171-4314145A675233212122322984555-----558A55325645D33323233325-989E8A9859325775BE6CDBBA63543333879843-4444444433432865-------------------------1-2-12441127733755457456556689455543548575423643722332334322345222442233332345555277573697669887978475A7564565BA7544314445542311111112233443555434343143355444333335533234--14433------23544343223333343-2432233332232223322533324343144434333353542543233334-422222222232--2-545551111434332222222222222234222213333533223567333455365523332233345344111112522335222222334434--75667788111111113-1----------1-1---13-1-----1133522221554 -1221-5-421146631111-1-211--------------------3221343311222111322-11-2-12-222-2212222232-11211313232121344-6D3733333222-123353-43894-343132-3-3321232132131423458557431234O45549566*DAA55SLRU1QJ78A7878 -----------------------2--------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 359 STR:RPRED 100.0 SQ:SECSTR HHHcTHHTEEEEEETTTcHHHHHHHHHHTTcTTEEEEcccTTTccTTcHHHHHHHHHHHHHHHHTTHHHHEEEEEccEEEEEccTTHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTHHTHTTccEEEEEccGGGccTTccccccGGGcccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTcccHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHcccHHHHHHHccHHHHHHTccTTcccEEEcccccEEHHHHEHHHHHHHHTcccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHHHHHHHHHHHHTTG DISOP:02AL 1-6| PSIPRED cccccccccEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHHccccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHccccEEEEEccccccccEEHHHHHHHHHHHHHccccccccccccccEEEEccccccEEHHHHHHHHHHHHccccccccccccccEEEEEcccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcc //