[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99815.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->229 2e7yB PDBj 2e-05 11.9 %
:HMM:SCOP  7->156 1e5dA2 d.157.1.3 * 0.00096 19.6 %
:HMM:PFM   14->69 PF06105 * Aph-1 4.9e-05 30.9 55/238  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99815.1 GT:GENE ABD99815.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1024604..1025500 GB:FROM 1024604 GB:TO 1025500 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD99815.1 GB:DB_XREF GI:90821176 LENGTH 298 SQ:AASEQ MEYNFENKFVETDETIIFFDNYINIDSPKEKFVIISHLSADNLAYLQQATLPAKTFVSQNLFLLLQKLTKFELIANLNLDLKVLPYGFAVSVADSKITALNSDDGLWGSMALYLEHDHQKLGYVAKFDIHGIHKKRIKAWKKFFSQQKLDYLILGYQDSDDSDNYLSKTGQLKNIEKTLEQADSTQIHLEMTPFDPEQLVKIDDLAHRLDYQIKWLPGYAELISYFKQLDFKEGSPAATDKNLIQRKAQAHIADDLTISSPLLAEDGKIDFMNNFAYPTEAELKEILKYIAAKQVYFV GT:EXON 1|1-298:0| RP:PDB:NREP 1 RP:PDB:REP 9->229|2e7yB|2e-05|11.9|218/269| HM:PFM:NREP 1 HM:PFM:REP 14->69|PF06105|4.9e-05|30.9|55/238|Aph-1| HM:SCP:REP 7->156|1e5dA2|0.00096|19.6|143/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 73.2 SQ:SECSTR ########EEEEGGGTEEEcHHHGGGGGGccEEEcccccHHHHHHHHHHHHccccEEEEEETTcHHHHHHHHHHHHHcGGGEEcTTccEEccTTTTccEEEEEEEcccEEEEEEEEEEEEcGGGTTccHHHHHHHHHHHcHHHHEEEEEEEEEEEccccccccHHHHTTccEEEEEcccccGGGcccTTccc###HHHHHHHHHTTccEEEEEccccTTTTHHHHHHHH##################################################################### DISOP:02AL 1-2| PSIPRED ccccccccEEccccEEEEEccccccccccEEEEEEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHHHHEEEEEcccccEEEEEccEEEEEcccEEEEEccccccEEEEEEEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHcccHHHHHHHHHHccccEEEEEEccccHHHHEHHHHHHHHcccEEEEcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccEEccccccccccEEEEcccccccHHHHHHHHHHHHcccEEEc //