[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99819.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->20 PF04967 * HTH_10 0.00048 38.9 18/53  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99819.1 GT:GENE ABD99819.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1029276..1029392) GB:FROM 1029276 GB:TO 1029392 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99819.1 GB:DB_XREF GI:90821180 LENGTH 38 SQ:AASEQ MSNEMSTLFAVSKSQIAEHLDVRFVIFKVVRRYKSGGN GT:EXON 1|1-38:0| HM:PFM:NREP 1 HM:PFM:REP 3->20|PF04967|0.00048|38.9|18/53|HTH_10| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,35-39| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //