[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99824.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.33
:248 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->176 1f5sB PDBj 2e-04 29.5 %
:RPS:PDB   7->229 2basA PDBj 3e-18 16.9 %
:RPS:SCOP  9->241 2basA1  c.1.33.1 * 7e-20 19.3 %
:HMM:SCOP  7->232 2basA1 c.1.33.1 * 1.9e-22 23.4 %
:RPS:PFM   14->232 PF00563 * EAL 5e-09 28.5 %
:HMM:PFM   8->230 PF00563 * EAL 3.6e-30 21.2 212/236  
:BLT:SWISS 76->232 PHY2_SYNY3 2e-08 27.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99824.1 GT:GENE ABD99824.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1035017..1035763) GB:FROM 1035017 GB:TO 1035763 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG2200 [T] FOG: EAL domain GB:PROTEIN_ID ABD99824.1 GB:DB_XREF GI:90821185 LENGTH 248 SQ:AASEQ MNSTLNIAPDNLTLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTDSKTKNFFIMSWINFAKTNNVELVIEGIEDDVAAKEMLCHNIKLQQGFFWQVPQDYISPKEVHNFKEFE GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 76->232|PHY2_SYNY3|2e-08|27.6|152/1276| BL:PDB:NREP 1 BL:PDB:REP 40->176|1f5sB|2e-04|29.5|122/209| RP:PDB:NREP 1 RP:PDB:REP 7->229|2basA|3e-18|16.9|207/393| RP:PFM:NREP 1 RP:PFM:REP 14->232|PF00563|5e-09|28.5|200/236|EAL| HM:PFM:NREP 1 HM:PFM:REP 8->230|PF00563|3.6e-30|21.2|212/236|EAL| RP:SCP:NREP 1 RP:SCP:REP 9->241|2basA1|7e-20|19.3|218/257|c.1.33.1| HM:SCP:REP 7->232|2basA1|1.9e-22|23.4|218/0|c.1.33.1|1/1|EAL domain-like| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------11----------------------------------------------------------11---------------------------------------------------------------------------1-111111-----------------------1-----------11---12111--------------------------------------------------11-----------2------1------------------------------------------1--------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------1-2--------------1--------------1---2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 232 STR:RPRED 93.5 SQ:SECSTR ##TEEcHTTTTEEEEEEEEEEcHccccccEEEEEEEEEETTEEEEcHHHHccccccHHHHHHHHHHHccHHHHHHHHTTcEEEEccHHHHGGTTHHHHHHHHHHHHTTGEEEEEccTTcccEcccHHHHHHHHHHHTTTcEEEEEEETTTcccHHHHHHHHHcccEEEEEcTTTcccHHHHTcHHHHHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTTEEEEccTTTccccc############## DISOP:02AL 246-249| PSIPRED ccHHHHHHcccEEEEEEEEEEEEcccccEEEEEEEEEEEcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHcccHHHHHHHHHccccccEEEEEEHHHHHccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccccEEEEEHHHHcccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEccHHccccccccHHHHHHHHHcc //