[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99828.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:394 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   92->200 PF10096 * DUF2334 2e-08 29.6 %
:HMM:PFM   90->294 PF10096 * DUF2334 3e-30 26.1 199/243  
:HMM:PFM   343->385 PF12420 * DUF3671 0.00092 30.2 43/104  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99828.1 GT:GENE ABD99828.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1040039..1041223) GB:FROM 1040039 GB:TO 1041223 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99828.1 GB:DB_XREF GI:90821189 LENGTH 394 SQ:AASEQ MIIRQQLTLSDNGITEQIPYTNRMEYLVDVADSDKYGVLNTQNVGNQKTLPYGVKVDNNAFLPFWNTSGLAVNCEEKLIADLFNAKTDSRPLLVINNVTPTSNLEYLDKLVDDLYRNNVPFAVSATNVEGNTNQFAYKKYMYSLRMIELKNGIVFMRVPYLYSYTGKEINAQNLKATMSERLQLMVRSGVYPTGLSTPNHWNQDVVLGKVGLKSASNVLLLPDPKTYPKVEQTDYSQEFDKAYYVMSLKDLDKAKTTVSLTKANNLNYTLSTALNIKMPRTLSELRKVEKSISNSELNWENPAAEDNSREMNFAKMKLEYHAGTYFVNGNEQNINDTAPVQKKHKHKEYQETGLNLILSYQGKFLTVFILVTLIGFVLLIYKGRKVYWDKFKRK GT:EXON 1|1-394:0| TM:NTM 1 TM:REGION 361->382| RP:PFM:NREP 1 RP:PFM:REP 92->200|PF10096|2e-08|29.6|108/223|DUF2334| HM:PFM:NREP 2 HM:PFM:REP 90->294|PF10096|3e-30|26.1|199/243|DUF2334| HM:PFM:REP 343->385|PF12420|0.00092|30.2|43/104|DUF3671| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-1--------------------1---------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 394-395| PSIPRED ccEEEEEEEcccccEEEccccccEEEEEEEccccEEEEEEHHHcccccccccEEEEccEEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEccEEEcEEcccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHcccccccccEEEcccccccccEEEccccccccHHHHHHHHcccccccccEEEEccccccccEEEEEEEEccccHHHHHHHHHHHHHccEEEEcccccccccEEccccEEEEEccccEEEcccEEEEEccccccccccHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHcccEEEHHHHccc //