[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99842.1
DDBJ      :             Peptidoglycan binding protein, LysM domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.7.1
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->71 2djpA PDBj 1e-06 33.3 %
:RPS:SCOP  33->71 1e0gA  d.7.1.1 * 1e-04 24.3 %
:HMM:SCOP  27->76 1e0gA_ d.7.1.1 * 2.5e-05 37.5 %
:HMM:PFM   31->71 PF01476 * LysM 8.5e-10 32.5 40/44  
:BLT:SWISS 33->73 LYS_BPPZA 2e-04 46.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99842.1 GT:GENE ABD99842.1 GT:PRODUCT Peptidoglycan binding protein, LysM domain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1057944..1058915 GB:FROM 1057944 GB:TO 1058915 GB:DIRECTION + GB:PRODUCT Peptidoglycan binding protein, LysM domain GB:NOTE COG0513 [LKJ] Superfamily II DNA and RNA helicases GB:PROTEIN_ID ABD99842.1 GB:DB_XREF GI:90821203 LENGTH 323 SQ:AASEQ MKLNKTLLSLTAATGIIATGAAANGAKADKITVKSSDTVSQLALDHATTVDNVQQLNNLENVDLIFVGQTLEMGDGSYTTTTYQTASQYQQNYAQNTDAQANYTQTDYSAAQNNVPAATDQVQDTTTTVDQTATPADTTTQDAQTNVASDTTTSEVQVDATNTDQAATTTNDAVSTGATTTQAQAEVQAPATTTYVENTPAEAPTTTWTDTTSSVNNTVANTNSNYSSASTTPAATTTATQNTTTSSTSSDEDAAREWIANKESGGSYTAKNGIYYGKYQLTATYLNGDYSAENQEKVANEYVASRYGSWTAAKAHWEANNWY GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 33->73|LYS_BPPZA|2e-04|46.3|41/258| SEG 11->32|taatgiiatgaaangakadkit| SEG 77->97|syttttyqtasqyqqnyaqnt| SEG 116->145|paatdqvqdttttvdqtatpadtttqdaqt| SEG 157->174|qvdatntdqaatttndav| SEG 176->194|tgatttqaqaevqapattt| SEG 196->255|ventpaeaptttwtdttssvnntvantnsnyssasttpaatttatqntttsstssdedaa| RP:PDB:NREP 1 RP:PDB:REP 33->71|2djpA|1e-06|33.3|39/77| HM:PFM:NREP 1 HM:PFM:REP 31->71|PF01476|8.5e-10|32.5|40/44|LysM| RP:SCP:NREP 1 RP:SCP:REP 33->71|1e0gA|1e-04|24.3|37/48|d.7.1.1| HM:SCP:REP 27->76|1e0gA_|2.5e-05|37.5|48/48|d.7.1.1|1/1|LysM domain| OP:NHOMO 65 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1242--222324433--231-1----111----1111--11111111--------------11111111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 39 STR:RPRED 12.1 SQ:SECSTR ################################ccTTccHHHHHHHHTccHHHHHHHHTccccccGGGcccE############################################################################################################################################################################################################################################################ DISOP:02AL 1-3,240-254| PSIPRED ccccHHHHHHHccccEEEcccccccccccEEEEEcccHHHHHHHHHccHHHHHHHHHccccccEEEEccEEEEccccEEEEEEHHHHHHHHHHHccccccccccccccHHHcccccccHHHcccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccEEccccccEEEccccccccccEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccc //