[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99844.1
DDBJ      :             Peptidoglycan binding protein, LysM domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.7.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->71 2djpA PDBj 7e-11 21.7 %
:RPS:SCOP  25->71 1e0gA  d.7.1.1 * 5e-10 22.2 %
:HMM:SCOP  25->74 1e0gA_ d.7.1.1 * 5.5e-09 33.3 %
:HMM:PFM   30->71 PF01476 * LysM 3.6e-15 34.1 41/44  
:BLT:SWISS 28->71 YOCH_BACSU 2e-07 53.5 %
:BLT:SWISS 139->217 ISAA_STAHJ 5e-06 40.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99844.1 GT:GENE ABD99844.1 GT:PRODUCT Peptidoglycan binding protein, LysM domain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1059960..1060613 GB:FROM 1059960 GB:TO 1060613 GB:DIRECTION + GB:PRODUCT Peptidoglycan binding protein, LysM domain GB:PROTEIN_ID ABD99844.1 GB:DB_XREF GI:90821205 LENGTH 217 SQ:AASEQ MKFNKALLSVTAAAGLLAVGTIAANADQVTVQPGDTVSKIAQEHNTTVDSIQQLNNLANVNLIYAGQTLEVGENGQATASDNATTTSATTNNYQLPAQTYNYNYQAATTPSYSYNNNNNYSYNANANTQATTNSGYNYQATGSSSEEAAKAWIANKESGGSYTATNGQYIGKYQLSASYLNGDYSAANQERVANQYVTSRYGSWVAAQQFWQSHGWY GT:EXON 1|1-217:0| BL:SWS:NREP 2 BL:SWS:REP 28->71|YOCH_BACSU|2e-07|53.5|43/287| BL:SWS:REP 139->217|ISAA_STAHJ|5e-06|40.3|77/238| SEG 77->92|atasdnatttsattnn| SEG 107->134|attpsysynnnnnysynanantqattns| RP:PDB:NREP 1 RP:PDB:REP 12->71|2djpA|7e-11|21.7|60/77| HM:PFM:NREP 1 HM:PFM:REP 30->71|PF01476|3.6e-15|34.1|41/44|LysM| RP:SCP:NREP 1 RP:SCP:REP 25->71|1e0gA|5e-10|22.2|45/48|d.7.1.1| HM:SCP:REP 25->74|1e0gA_|5.5e-09|33.3|48/48|d.7.1.1|1/1|LysM domain| OP:NHOMO 70 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1242--222327733--231------111----1111--11111111--------------11111111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 27.6 SQ:SECSTR ###########ccccccccccccEEEEEEcccTTccHHHHHHHHTccHHHHHHHHTccccccGGGcccEEE################################################################################################################################################## DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHcccHHHHHHHcccccccEEccccEEEEcccccccccccccccccccccccccccEEEEEEccccccccccccccccEEccccccccccccccEEEccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccc //