[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99845.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.159.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->127 2dfjA PDBj 6e-04 27.8 %
:RPS:PDB   2->234 3ck2A PDBj 3e-05 19.8 %
:RPS:PDB   5->76 2dfjA PDBj 1e-09 29.2 %
:RPS:SCOP  4->240 1nnwA  d.159.1.5 * 5e-21 18.1 %
:HMM:SCOP  1->254 1nnwA_ d.159.1.5 * 1.2e-46 31.8 %
:HMM:PFM   4->169 PF00149 * Metallophos 8.4e-15 20.5 166/200  
:BLT:SWISS 5->210 Y912_METJA 3e-11 31.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99845.1 GT:GENE ABD99845.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1060687..1061544) GB:FROM 1060687 GB:TO 1061544 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0639 [T] Diadenosine tetraphosphatase and related serine/threonine protein phosphatases GB:PROTEIN_ID ABD99845.1 GB:DB_XREF GI:90821206 LENGTH 285 SQ:AASEQ MGERIAVFSDVHGNTTALEAVYQDSIKQKVDKYWFLGDLFSPGPGAQDLWDLFKQINPEICIRGNWDDLFLNALRGVVDTDRTSLVYISKLAQTLSERLDANEVTSTIKKWPIREETRVRDIRVGLTHNLPDLNYGQALYPTEKQRNFNELFDGNQNLDLAIYAHVHHPLMRYSSDEQFVLNPGSVGQPFFAWDKFQKDMRAEYLILEIDEHGIQETNFRKVYYDRDLEYKRAELANLPYLDIYKLQLVTGKVHTHDHELMKKINDERGYLNDVIKFNEKVRKKG GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 5->210|Y912_METJA|3e-11|31.4|188/243| BL:PDB:NREP 1 BL:PDB:REP 7->127|2dfjA|6e-04|27.8|115/267| RP:PDB:NREP 2 RP:PDB:REP 2->234|3ck2A|3e-05|19.8|167/171| RP:PDB:REP 5->76|2dfjA|1e-09|29.2|72/267| HM:PFM:NREP 1 HM:PFM:REP 4->169|PF00149|8.4e-15|20.5|166/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 4->240|1nnwA|5e-21|18.1|227/251|d.159.1.5| HM:SCP:REP 1->254|1nnwA_|1.2e-46|31.8|239/251|d.159.1.5|1/1|Metallo-dependent phosphatases| OP:NHOMO 91 OP:NHOMOORG 72 OP:PATTERN -----1-----------------------------------------------11111-1111----- ---------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------211--------11111112111121111----111------------1--------------------------11-1---221122-1---1----------2--22232123212-------------1-------------1-------1-1----1111-------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 81.8 SQ:SECSTR #cccEEEEccccccHHHHHHHHHHTTccTTcEEEEccccccccccHHHHHHHHHHTGGEEEcccHHHHHHHHHHTTHHHHHHHHHHccHHHHHHHHHHHTTcccEEEETTcccTHHHHccccccccccHHHHHHHcEEcTTccccHHHHHHHHHHHTccEEEEcccccTcEEEETTTTEEEEcccccGGcccTTccccHHHcEEEEEETTTTEEEEEEcEccccEEEccccccc################################################### DISOP:02AL 1-1,283-286| PSIPRED cccEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHccccEEEccccHHHHHHHHcccccccccccHHHHHHHHHHHHHccHHHHHHHHHHccccccEEEccEEEEEEEccccccccccccccccHHHHHHHHcccccccEEEEccccHHHHHcccccEEEEEccccccccccccccccccccEEEEEEEEcccEEEEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHcc //