[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99846.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:259 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->129 1z84A1  d.13.1.2 * 3e-18 24.2 %
:HMM:SCOP  11->130 1z84A1 d.13.1.2 * 1.3e-20 27.5 %
:HMM:PFM   62->129 PF01087 * GalP_UDP_transf 7.4e-06 25.0 68/183  
:BLT:SWISS 7->132 APA1_YEAST 4e-05 28.6 %
:BLT:SWISS 144->252 DTPT_LACHE 5e-07 26.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99846.1 GT:GENE ABD99846.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1061553..1062332) GB:FROM 1061553 GB:TO 1062332 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG1085 [C] Galactose-1-phosphate uridylyltransferase GB:PROTEIN_ID ABD99846.1 GB:DB_XREF GI:90821207 LENGTH 259 SQ:AASEQ MSNEEPLIFHLQVARKKPENIKHPEGYCPFCDRENLTNILDKDGDCIWLVNKFRTLQDTMQTIIIESKDHLGDQSSYSQLENRKIIKYALECWQKMINQNKYKSVLLYKNFGPRSGGSLRHPHFQIVGLDKKDGYANISSKNFQGVDVVSKNNVQLNISRYPLKGFVEFNVQMSQDGDVATFADYIQSTVKFILSDDFYHGHYDSYNLFFYNIDQKIECKIMPRYVASPYFIGYQISQVNNEESLMQIAEALQKRILAE GT:EXON 1|1-259:0| BL:SWS:NREP 2 BL:SWS:REP 7->132|APA1_YEAST|4e-05|28.6|119/100| BL:SWS:REP 144->252|DTPT_LACHE|5e-07|26.7|105/497| HM:PFM:NREP 1 HM:PFM:REP 62->129|PF01087|7.4e-06|25.0|68/183|GalP_UDP_transf| RP:SCP:NREP 1 RP:SCP:REP 6->129|1z84A1|3e-18|24.2|124/154|d.13.1.2| HM:SCP:REP 11->130|1z84A1|1.3e-20|27.5|120/0|d.13.1.2|1/1|HIT-like| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-111111------111-------------1----------------------2------11111-----1----111111---------------------------------------------1-------1-1------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,18-20,259-260| PSIPRED ccccccEEEccHHHHccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEcccccccHHHccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccEEEEEEccccccccccHHHcccEEEEccccEEEEEEccccccEEEEEEEEEccccHHHHHHHHHHHHEEEEEEHHccccccEEEEEEEEEcccEEEEEEEccccccccEEEEccccccHHHHHHHHHHHHHHHHcc //