[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99847.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->152 PF11207 * DUF2989 0.00057 19.0 58/203  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99847.1 GT:GENE ABD99847.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1062483..1062956) GB:FROM 1062483 GB:TO 1062956 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABD99847.1 GB:DB_XREF GI:90821208 LENGTH 157 SQ:AASEQ MINKKLPYIYFKTKSFHVYLRLWKLDDEWIGVSYSVRAYNSEEFYQGGSPLSNWYHDDLTVLLNEIDELMIMDEYVNTFEPLDDPYLDIVLKSKSGKKHLRINFYWDPTESRDHLSVYLNSKQIENLNMYLSLATGKITKDNEQIKILYDQGILQGD GT:EXON 1|1-157:0| HM:PFM:NREP 1 HM:PFM:REP 95->152|PF11207|0.00057|19.0|58/203|DUF2989| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,157-158| PSIPRED cccccccEEEEEEcEEEEEEEEEEEcccEEEEEEEEEEEcHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccEEEEEEEEEcccccccEEEEEEcccEEccEEEEEEEEccEEcccccEEEEEEEccccccc //