[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99864.1
DDBJ      :             Cell division protein mraZ
Swiss-Prot:MRAZ_LACS1   RecName: Full=Protein mraZ;

Homologs  Archaea  0/68 : Bacteria  526/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->117 1n0fB PDBj 4e-17 32.5 %
:RPS:SCOP  1->120 1n0eA  b.129.1.2 * 7e-50 31.7 %
:HMM:SCOP  1->137 1n0eA_ b.129.1.2 * 6e-51 54.7 %
:RPS:PFM   1->59 PF02381 * MraZ 8e-16 59.3 %
:RPS:PFM   73->120 PF02381 * MraZ 2e-07 39.6 %
:HMM:PFM   1->70 PF02381 * MraZ 1.5e-27 38.6 70/72  
:HMM:PFM   72->141 PF02381 * MraZ 1.8e-28 41.4 70/72  
:BLT:SWISS 1->143 MRAZ_LACS1 2e-70 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99864.1 GT:GENE ABD99864.1 GT:PRODUCT Cell division protein mraZ GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1081281..1081712) GB:FROM 1081281 GB:TO 1081712 GB:DIRECTION - GB:PRODUCT Cell division protein mraZ GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99864.1 GB:DB_XREF GI:90821225 LENGTH 143 SQ:AASEQ MFMGEYRHTIDAKGRLIVPAKFREQLGDSFVVTRGMDGCLFGYTQEEWNILETKLQKLPLTKKDARAFVRFFYSAATECEIDKQGRINIPKSLRTHAALQKKCVVVGVSNRFEIWSEDRWEAFADEAEENFDDIAENMIDFDL GT:EXON 1|1-143:0| SW:ID MRAZ_LACS1 SW:DE RecName: Full=Protein mraZ; SW:GN Name=mraZ; OrderedLocusNames=LSL_1056; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|MRAZ_LACS1|2e-70|100.0|143/143| SEG 121->137|eafadeaeenfddiaen| BL:PDB:NREP 1 BL:PDB:REP 1->117|1n0fB|4e-17|32.5|117/139| RP:PFM:NREP 2 RP:PFM:REP 1->59|PF02381|8e-16|59.3|59/69|MraZ| RP:PFM:REP 73->120|PF02381|2e-07|39.6|48/69|MraZ| HM:PFM:NREP 2 HM:PFM:REP 1->70|PF02381|1.5e-27|38.6|70/72|MraZ| HM:PFM:REP 72->141|PF02381|1.8e-28|41.4|70/72|MraZ| RP:SCP:NREP 1 RP:SCP:REP 1->120|1n0eA|7e-50|31.7|120/141|b.129.1.2| HM:SCP:REP 1->137|1n0eA_|6e-51|54.7|137/0|b.129.1.2|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 530 OP:NHOMOORG 527 OP:PATTERN -------------------------------------------------------------------- 1--1111111111111111-11111111111111111111111111111111111111111111111---1111111111111-----11---------1-111111-11---------------11-111111-12221111111-------------------------------------1111111-1-1---------------111111------11--11111111111111111111111111111-111111111111111111111-----------------------------------------------1111111111111111-------1111111111111111111111111---1---------------------------------------------1---------------1-11---1---11--------1--1---------------------------------------111111111111111111111-11111111111-1111111111111111111111111111111111111-1111111111111111111111111111111-------------------------11111111111111111111111111111111---1111------11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111-1111111-11111111----------1111111111111111111---------1--------------11111111111111------------------11-----1-111111111111-11-111----------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 81.8 SQ:SECSTR ccccEEEEcccTTcEEEcccHHHHHcccEEccccccccccEEccHHHHHHHHHHHHTcccccHHHHHHHHHHHTTcccEEccTTcEEEccHHHHHHTTccccEEEEEccccEEEEEH########################## DISOP:02AL 57-59,61-61| PSIPRED cccccccccccccccEEEcHHHHHHHcccEEEEEccccEEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHccEEEEEEcccccEEEcHHHHHHcccccEEEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccc //