[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99865.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->112 PF11877 * DUF3397 7e-04 35.7 %
:HMM:PFM   1->117 PF11877 * DUF3397 3.2e-28 32.2 115/116  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99865.1 GT:GENE ABD99865.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1081929..1082294) GB:FROM 1081929 GB:TO 1082294 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABD99865.1 GB:DB_XREF GI:90821226 LENGTH 121 SQ:AASEQ MLRSWIVQLCVVVFLWIVLTMFKNRFKNIWPRRLKKLDVLCIFLIIAIHFTSIELIGISLFPYLMFVMSVVGLIMIFASAYRSGDIVYGVFWTRFIRILDLVTLFTYFIVLIMTIFKAILL GT:EXON 1|1-121:0| TM:NTM 4 TM:REGION 2->23| TM:REGION 37->59| TM:REGION 62->84| TM:REGION 97->119| RP:PFM:NREP 1 RP:PFM:REP 1->112|PF11877|7e-04|35.7|112/117|DUF3397| HM:PFM:NREP 1 HM:PFM:REP 1->117|PF11877|3.2e-28|32.2|115/116|DUF3397| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //