[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99869.1
DDBJ      :             Polar amino acid ABC transporter, substrate binding protein
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  658/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->269 3hv1B PDBj 7e-67 54.7 %
:RPS:PDB   49->270 3delB PDBj 3e-37 19.9 %
:RPS:SCOP  61->269 1ii5A  c.94.1.1 * 4e-41 17.5 %
:HMM:SCOP  1->273 2a5sA1 c.94.1.1 * 2.5e-63 34.9 %
:RPS:PFM   54->268 PF00497 * SBP_bac_3 3e-32 36.4 %
:HMM:PFM   46->269 PF00497 * SBP_bac_3 3.7e-62 35.5 217/225  
:BLT:SWISS 49->268 ARTP_BACSU 6e-29 32.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99869.1 GT:GENE ABD99869.1 GT:PRODUCT Polar amino acid ABC transporter, substrate binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1084831..1085688) GB:FROM 1084831 GB:TO 1085688 GB:DIRECTION - GB:PRODUCT Polar amino acid ABC transporter, substrate binding protein GB:NOTE COG0834 [ET] ABC-type amino acid transport/signal transduction systems, periplasmic component/domain GB:PROTEIN_ID ABD99869.1 GB:DB_XREF GI:90821230 LENGTH 285 SQ:AASEQ MKKIVKIITCLLAFLIVGATLAGCTNVRKRANGQDNWKKIEKKKKVVIGLDDSFVPMGFREKDGSLVGFDVDLAREVFKRYGIDVDFQTIDWSMKETELRNGTIDLIWNGYTVNPERKKTVAFSVPYLRNQQVLVSKKKENVYDAKSMKGKALGLQSGSSGYESYMSQPKLLKNYVKEAVQYDTFNNAFLDLNANRIQGLLIDSVYADYYVAHEPDPNSYRISDVGFESENFAVGMRKGDKTLQKKINMALAQMAKDGTLQKISNKWFGTTKMVPLKEIENQKID GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 49->268|ARTP_BACSU|6e-29|32.1|215/255| TM:NTM 1 TM:REGION 4->26| SEG 38->48|kkiekkkkvvi| BL:PDB:NREP 1 BL:PDB:REP 31->269|3hv1B|7e-67|54.7|234/249| RP:PDB:NREP 1 RP:PDB:REP 49->270|3delB|3e-37|19.9|216/232| RP:PFM:NREP 1 RP:PFM:REP 54->268|PF00497|3e-32|36.4|209/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 46->269|PF00497|3.7e-62|35.5|217/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 61->269|1ii5A|4e-41|17.5|200/222|c.94.1.1| HM:SCP:REP 1->273|2a5sA1|2.5e-63|34.9|252/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2981 OP:NHOMOORG 689 OP:PATTERN -----1----------1-2221112--11-1111----75883-1113----1----1------1--- -----31222222231111-14--1411111143332455-1122111121-535221--11--5334331544443321321--------------------------1-111111---------------2---111111111---14--21111-------111113-------------1431111--2534444475445544532326644532154344444439422222222222222222222564687765556666883646843336664444365666767765673333233333333387BAA77751444A453555523242332333-311-3213155-4121-211111128---111-432231172---------5552526556G---5--5-938-1IDDAFEDHEHAC94----1421221211111111122211113----------1111--11111-11---1-------49778EHHHIF67887CCEK888868ICG6A64-19873385494B8EA112---1753322222---11-13A1676936866636156-42--21-11--4-5335333333111111111-22----554-2-----5-1111--11111111-11-2-4-1--------88BD5987776775777-7787777677777677668DGDBA442B869898888988898C766767731878888887888--3----1-4454--26633343422121222133333-23651-BA8B8FBE667672878----------33364444444533----------------17--------------2231------------------------121-122212--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1--2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 100.0 SQ:SECSTR TTTccEEEEEEEEEEEEEcccTTTcEEHHHEEccccccccTTcEEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEccccccccGGGcccEEEETTcHHHHHHHHcTTcHHTTcHcEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGcHHHEEccHHHTTcE DISOP:02AL 1-1,27-39,283-286| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEcccccccEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHccccEEEccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHccccccc //