[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99886.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->103 2ohwA PDBj 4e-07 27.1 %
:RPS:PFM   1->128 PF07997 * DUF1694 5e-14 40.0 %
:HMM:PFM   1->128 PF07997 * DUF1694 9.9e-40 38.3 120/120  
:BLT:SWISS 1->103 YUEI_BACSU 3e-07 27.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99886.1 GT:GENE ABD99886.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1102717..1103199 GB:FROM 1102717 GB:TO 1103199 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD99886.1 GB:DB_XREF GI:90821247 LENGTH 160 SQ:AASEQ MTNDNLQEHLNNGLYGTPQLHPDEQHKYLGTFRERVSLAITFKEFSNNQNACLTAIKQEISSNTEEKLSIKINGQLSSDIIDKIIQISKENNTKFEYLADTSFSHDDDANAIVICSSKSALHIENIDVESKYHELFERKAEKNNDPKEDKKGFLSKLFDL GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 1->103|YUEI_BACSU|3e-07|27.3|99/100| SEG 77->89|ssdiidkiiqisk| BL:PDB:NREP 1 BL:PDB:REP 4->103|2ohwA|4e-07|27.1|96/128| RP:PFM:NREP 1 RP:PFM:REP 1->128|PF07997|5e-14|40.0|115/119|DUF1694| HM:PFM:NREP 1 HM:PFM:REP 1->128|PF07997|9.9e-40|38.3|120/120|DUF1694| OP:NHOMO 16 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-1---331111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 60.0 SQ:SECSTR ###HHHHHHHHTTcccccccHHHHHHHTTTccGGGEEEEEEHHHHTccc####ccHHHHHHHHTcccEEEEEETTccHHHHHHHHHHHHHTTccEEEEccccc######################################################### DISOP:02AL 1-3,135-151| PSIPRED cccHHHHHHHHHHccccccccHHHHHHHHccccEEEEEEEcHHHHHHccccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEEcccccccccccHHHHcccHHccHHcccccccHHHccHHHHHHcc //