[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99894.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  130/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   98->157 3c6fD PDBj 1e-05 31.7 %
:RPS:PDB   98->158 3c6fA PDBj 1e-07 31.1 %
:RPS:PFM   93->164 PF04239 * DUF421 5e-10 38.9 %
:HMM:PFM   91->162 PF04239 * DUF421 3.8e-23 37.5 72/99  
:HMM:PFM   7->78 PF04893 * Yip1 0.00059 25.0 64/173  
:BLT:SWISS 9->167 YRBG_BACSU 1e-15 30.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99894.1 GT:GENE ABD99894.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1111928..1112479) GB:FROM 1111928 GB:TO 1112479 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0344 [S] Predicted membrane protein GB:PROTEIN_ID ABD99894.1 GB:DB_XREF GI:90821255 LENGTH 183 SQ:AASEQ MKNKIDYYLPIIIKFVLGLLVFILQINLTGKGNLAPSTALDAVQNYVLGGIIGGVIYNENITILQFVMVLIVWTIIVLTLKFFKDHNRFIRNIIDGQPVTLIKNGKIRVEECLKHGISANDLMFKLRNKGIYEVAKVKSGILEQNGQLTVIEFSDKDHVRYPLISDGQLMLMYWNLLTKMKNG GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 9->167|YRBG_BACSU|1e-15|30.8|159/218| TM:NTM 2 TM:REGION 7->29| TM:REGION 61->83| SEG 49->56|ggiiggvi| BL:PDB:NREP 1 BL:PDB:REP 98->157|3c6fD|1e-05|31.7|60/138| RP:PDB:NREP 1 RP:PDB:REP 98->158|3c6fA|1e-07|31.1|61/137| RP:PFM:NREP 1 RP:PFM:REP 93->164|PF04239|5e-10|38.9|72/80|DUF421| HM:PFM:NREP 2 HM:PFM:REP 91->162|PF04239|3.8e-23|37.5|72/99|DUF421| HM:PFM:REP 7->78|PF04893|0.00059|25.0|64/173|Yip1| OP:NHOMO 168 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------11--------------------1------------------------------------------------------------------------------------------132111112111121122333323111-1121--------21--------------------111-11--1-111111111-11-111-------111111111-1-1--------------1----------21312223243-2-11---111-11------1111212111---1--11--------1111---------------------------------1---------------------------------------------------------------------------------1------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------11-------------------1-------------1---11111111111111111------------------------1-------------1---------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 54.1 SQ:SECSTR ##############################################################HHHHTTcEEEccccccTTTccTTTcTTccccccTTcEEEEETTEEcHHHHHHTTccHHHHHHHHHHTTcccGGGEEEEEEcTTccEEEEEcGGGccHHH###################### DISOP:02AL 1-1,180-184| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccHHHHHHHHHHcccccHHHEEEEEEEccccEEEEEccccccccccEEEEEEHHHHHHHHHcccccc //