[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99900.1
DDBJ      :             Short chain dehydrogenase
Swiss-Prot:             

Homologs  Archaea  47/68 : Bacteria  846/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->233 1xg5A PDBj 5e-22 31.5 %
:RPS:PDB   4->267 1dohB PDBj 7e-40 15.6 %
:RPS:SCOP  7->228 1xg5A  c.2.1.2 * 1e-38 31.1 %
:HMM:SCOP  8->271 1zemA1 c.2.1.2 * 2.9e-71 35.9 %
:RPS:PFM   13->179 PF00106 * adh_short 3e-18 35.6 %
:HMM:PFM   13->180 PF00106 * adh_short 1.9e-35 23.9 163/167  
:BLT:SWISS 7->269 YQJQ_BACSU 7e-58 46.7 %
:PROS 149->177|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99900.1 GT:GENE ABD99900.1 GT:PRODUCT Short chain dehydrogenase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1121017..1121826) GB:FROM 1121017 GB:TO 1121826 GB:DIRECTION - GB:PRODUCT Short chain dehydrogenase GB:NOTE COG0300 [R] Short-chain dehydrogenases of various substrate specificities GB:PROTEIN_ID ABD99900.1 GB:DB_XREF GI:90821261 LENGTH 269 SQ:AASEQ MKNYKSLKDLTNKVVLITGASGGLGEQIAYQVAKKGAIVVACARRKEKLDVVVENCQNLSKRLAYAYQLDISKPEEVEKVVNEVEEEVGPVSVLINNAGFGLMEDFLDFDMDRAEAMFRVNVLGLMYATKYVATKMAERQVGAIINIASMAGKMATPKSTVYSATKFAVLGFSNALRLELKPLGISVMTVNPGPIRTEFFDKADKTHNYLNSLGNIVLDPEEVAYKIVSKIGTSRREVNLPYYMEVAHHLYEVFPHMADYLTGGIFNKK GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 7->269|YQJQ_BACSU|7e-58|46.7|259/259| PROS 149->177|PS00061|ADH_SHORT|PDOC00060| SEG 75->93|eevekvvneveeevgpvsv| BL:PDB:NREP 1 BL:PDB:REP 12->233|1xg5A|5e-22|31.5|222/254| RP:PDB:NREP 1 RP:PDB:REP 4->267|1dohB|7e-40|15.6|256/271| RP:PFM:NREP 1 RP:PFM:REP 13->179|PF00106|3e-18|35.6|163/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 13->180|PF00106|1.9e-35|23.9|163/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 7->228|1xg5A|1e-38|31.1|222/254|c.2.1.2| HM:SCP:REP 8->271|1zemA1|2.9e-71|35.9|259/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 10205 OP:NHOMOORG 1087 OP:PATTERN 111-21344464535326-111--83365336-1---------11-43--612-321-1-22643-45 AEK1M214447651UUUEE-EQ44SrEDEEFMYacaGRhb1D6NI455173-D79437--99B2A8DFG63-222---2234I11212234312111--86O396xDP4D1111111---1111455468746565977BA222B5HBHG65666331214632448IDc8112121212232C765566-B7GCCCCCBBDECDCBCBG9FFCICCB8DCGJD7977795ES6555554444555448AA7952827825111BE5556665289888545544534523343343233363355665665533233233355357A444444464663773574441112722166121-2533333545452BR99D12212I8TKI348EGCBC7788788888F-DEEDDOGIJNG2eJJEXONdlYWPBEAF7A6GA7ADB96666666667AA94696--111---11-1--11--1--1---1--158IHA68FB9FeTXScWD99A9MNYSBBBB39eKbIcRP39LKFA889A8BLDPJ5E61879762232222329CB56J3821121-422224673833545886IL1412221222231132322322322163267867A99A8924343386755375574691-2333411-1119BDI4G88896888899-9889878889978998999GKIF95798578998888878789G67766572167688778878711174643467772CECF222437222213352FHEFI8E488E7HJAH9FMOGFEJGFHGG6434353342766E87887A978877CCCCB4442-1-1123EE87BB--------2-3----2---2-1------2-------4334254565381 12-1SNF-B53137CGFLHKGIHPOQVDF9AABA9A5B9A99A655IDJUKOcWEKFE8CAB24A46646337882323346658779-HWGF6Z74445726IG8-BFB*agPQYKA7A8IMBXQ8Q7g*P-NHVDDD8QCDOIBHD96J36JEQOYdjpSDfQSJPLWrFPZX5653M2327JACDZGTFA9C8787 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 99.6 SQ:SECSTR ccccGGGGccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHccTTccEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGGGcTTccccccccTTccHHHHHHHHHHHccTTcccccHHHHHHHHHHHHcGGGTTccccEEET# DISOP:02AL 1-5,269-270| PSIPRED cccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHcHHHHHHHHHHHHccc //