[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99918.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y1110_LACS1  RecName: Full=UPF0297 protein LSL_1110;

Homologs  Archaea  0/68 : Bacteria  177/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->81 PF06135 * DUF965 5e-24 73.1 %
:HMM:PFM   5->82 PF06135 * DUF965 6.1e-45 69.2 78/79  
:BLT:SWISS 1->86 Y1110_LACS1 4e-47 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99918.1 GT:GENE ABD99918.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1136545..1136805) GB:FROM 1136545 GB:TO 1136805 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99918.1 GB:DB_XREF GI:90821279 LENGTH 86 SQ:AASEQ MSALDKTMYFDFGQNEKKDVHQTLETVYNSLEEKGYNPINQIVGYLLSGDPAYIPRLNDARNLIRKHERDEIIEELVRAYLDKGEK GT:EXON 1|1-86:0| SW:ID Y1110_LACS1 SW:DE RecName: Full=UPF0297 protein LSL_1110; SW:GN OrderedLocusNames=LSL_1110; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->86|Y1110_LACS1|4e-47|100.0|86/86| RP:PFM:NREP 1 RP:PFM:REP 4->81|PF06135|5e-24|73.1|78/79|DUF965| HM:PFM:NREP 1 HM:PFM:REP 5->82|PF06135|6.1e-45|69.2|78/79|DUF965| OP:NHOMO 177 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,83-87| PSIPRED ccccHHEEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //