[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99940.1
DDBJ      :             Transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->75 3d1nN PDBj 2e-07 11.1 %
:RPS:SCOP  3->75 2ao9A1  a.4.1.17 * 3e-06 10.3 %
:HMM:PFM   124->201 PF07423 * DUF1510 6.8e-06 23.7 76/217  
:HMM:PFM   83->150 PF06024 * DUF912 0.00013 16.7 66/101  
:BLT:SWISS 18->71 YMFM_BACSU 4e-17 66.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99940.1 GT:GENE ABD99940.1 GT:PRODUCT Transcriptional regulator GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1163682..1164608) GB:FROM 1163682 GB:TO 1164608 GB:DIRECTION - GB:PRODUCT Transcriptional regulator GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABD99940.1 GB:DB_XREF GI:90821301 LENGTH 308 SQ:AASEQ MTDIGKTLQNARNEKHYTLDDLQQITKIQKRYLIAIEENNFDALPGDFYVRAFIRQYADTVGIKADKLLSELDEQAGKKKVEETEEEPTEAKTRTEAVRRQQQSSTPSQVSQSFDKFMHYLPTIIIVGVVVIIIGSIYFVVAGNKKEANQAASSTNVSISSDVSSSKKSSKKESSSEEVSSSSSKKESSSSSESSKSSKGQKITNTAVSGSRFTYSLTSPAKKNKIKFTSKGGSAWSSISVNGTANWQGTLQNGASHTVTLPEGTTSFNISLGNSNVTNITINGKKFDFLKENSTLTVRQITVNVANE GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 18->71|YMFM_BACSU|4e-17|66.7|54/288| TM:NTM 1 TM:REGION 120->142| SEG 78->96|kkkveeteeepteaktrte| SEG 101->113|qqqsstpsqvsqs| SEG 124->141|iiivgvvviiigsiyfvv| SEG 153->199|sstnvsissdvssskksskkessseevssssskkesssssesskssk| RP:PDB:NREP 1 RP:PDB:REP 1->75|3d1nN|2e-07|11.1|72/82| HM:PFM:NREP 2 HM:PFM:REP 124->201|PF07423|6.8e-06|23.7|76/217|DUF1510| HM:PFM:REP 83->150|PF06024|0.00013|16.7|66/101|DUF912| RP:SCP:NREP 1 RP:SCP:REP 3->75|2ao9A1|3e-06|10.3|68/117|a.4.1.17| OP:NHOMO 89 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1--------------------------------------------------------11-------------------------1------------------------111111111111111111111111111111111111111111--------------------11111111111111111111111111----------------------------------------------------------------------------111112-11--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 24.7 SQ:SECSTR HHHHHHHHHHHHHHTTccHHHHHHHHHHHcGGGcHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHccccH######################################################################################################################################################################################################################################## DISOP:02AL 1-1,75-113,147-208,307-309| PSIPRED cHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEEccccEEEEEEEcccEEEEEEEEccccEEEEccccEEEEEEEEEccccEEEEEEcccccccccccccEEEEEEEEEccc //