[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99949.1
DDBJ      :             Copper homeostasis protein cutC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.30
:187 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->139 2bdqA PDBj 3e-09 29.6 %
:RPS:SCOP  8->149 1twdA  c.1.30.1 * 7e-16 23.5 %
:HMM:SCOP  2->167 1twdA_ c.1.30.1 * 1.6e-15 28.8 %
:RPS:PFM   33->164 PF03932 * CutC 6e-13 36.5 %
:HMM:PFM   8->157 PF03932 * CutC 9.6e-15 30.6 144/202  
:BLT:SWISS 33->164 Y363_STRP6 7e-09 26.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99949.1 GT:GENE ABD99949.1 GT:PRODUCT Copper homeostasis protein cutC GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1175325..1175888) GB:FROM 1175325 GB:TO 1175888 GB:DIRECTION - GB:PRODUCT Copper homeostasis protein cutC GB:PROTEIN_ID ABD99949.1 GB:DB_XREF GI:90821310 LENGTH 187 SQ:AASEQ MIFKDTRVNSLSELVNVIKQGTHRVTLKNHEATVSKGFMAEAIKYAHEHDVSVNVVINIPTETSYQYSDIEIKALEADIFEAQALGADSIEFLALNEDGSFDVETADQFLAACGGMEGTINLSNIQFTNDQLEKIAEWVEKKQISRVYTDNDSTDELIKLKEVLPNIVPATISLEAAEKLEFKQIQL GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 33->164|Y363_STRP6|7e-09|26.7|131/209| BL:PDB:NREP 1 BL:PDB:REP 2->139|2bdqA|3e-09|29.6|135/205| RP:PFM:NREP 1 RP:PFM:REP 33->164|PF03932|6e-13|36.5|126/202|CutC| HM:PFM:NREP 1 HM:PFM:REP 8->157|PF03932|9.6e-15|30.6|144/202|CutC| GO:PFM:NREP 2 GO:PFM GO:0005507|"GO:copper ion binding"|PF03932|IPR005627| GO:PFM GO:0055070|"GO:copper ion homeostasis"|PF03932|IPR005627| RP:SCP:NREP 1 RP:SCP:REP 8->149|1twdA|7e-16|23.5|136/234|c.1.30.1| HM:SCP:REP 2->167|1twdA_|1.6e-15|28.8|160/0|c.1.30.1|1/1|CutC-like| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----------------------1-1-11-----11--11111--------1-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 84.0 SQ:SECSTR #cEEEEEEETTTTGGGccTTTccEEEEEccGGcccHHHHHHHHHHHHHTTcEEEEcc##cccccccccHHHHHHHHHHHHHHHHTTccEEEEccccTTccccHHHHHHHHHHHTTccEEEcGGGGccTTTHHHHHHHHH####ccEEEEcTTcccTTTTHHHHH####################### PSIPRED cEEEEEEEccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEcHHHHcccccHHHHHHHHHHccccEEEccccccHHHcccccHHHHHccccHHHHHHHHcccccccc //