[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99954.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  336/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.320.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   119->236 2fb5A PDBj 1e-29 52.5 %
:RPS:PDB   116->261 3c1yA PDBj 4e-04 19.1 %
:RPS:SCOP  89->238 2fb5A1  d.320.1.1 * 6e-49 42.0 %
:HMM:SCOP  42->241 2fb5A1 d.320.1.1 * 3.5e-67 50.0 %
:RPS:PFM   118->237 PF02457 * DisA_N 2e-37 64.7 %
:HMM:PFM   116->236 PF02457 * DisA_N 1.7e-48 55.4 121/122  
:BLT:SWISS 12->252 YBBP_BACSU 3e-72 56.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99954.1 GT:GENE ABD99954.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1180037..1180885) GB:FROM 1180037 GB:TO 1180885 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0011 [S] Uncharacterized conserved protein GB:PROTEIN_ID ABD99954.1 GB:DB_XREF GI:90821315 LENGTH 282 SQ:AASEQ MPFDWSNLITTQHLINLLDVAVVWYAIYKLMMLLRGTKAVQLFKGIVVIVIIKLLSWYIGLSTVSWIMDQVINWGIIAIIIIFQPEIRRGLEHLGRGTFVHNRKQGAEEEKMVKALDQAIQYMSKRRIGALITIQMNTGLEDYIETGIKLDADITGALLINIFIPNTPLHDGAVIIKDNKIAVAAAYLPLSESNLIPKALGTRHRAAVGISEVTDALTIVVSEETGGVTITKNSELLRDLTQNDYLKLLRNELIPKQEVKNDNILTKFVDGFAKSFKGGRKH GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 12->252|YBBP_BACSU|3e-72|56.4|241/273| TM:NTM 3 TM:REGION 13->35| TM:REGION 40->62| TM:REGION 66->87| SEG 46->52|ivvivii| SEG 71->88|vinwgiiaiiiifqpeir| BL:PDB:NREP 1 BL:PDB:REP 119->236|2fb5A|1e-29|52.5|118/204| RP:PDB:NREP 1 RP:PDB:REP 116->261|3c1yA|4e-04|19.1|141/349| RP:PFM:NREP 1 RP:PFM:REP 118->237|PF02457|2e-37|64.7|116/118|DisA_N| HM:PFM:NREP 1 HM:PFM:REP 116->236|PF02457|1.7e-48|55.4|121/122|DisA_N| RP:SCP:NREP 1 RP:SCP:REP 89->238|2fb5A1|6e-49|42.0|150/201|d.320.1.1| HM:SCP:REP 42->241|2fb5A1|3.5e-67|50.0|200/0|d.320.1.1|1/1|YojJ-like| OP:NHOMO 371 OP:NHOMOORG 337 OP:PATTERN -------------------------------------------------------------------- -11--------------------------------------------------------------------------------11111111111111---1--111111111-111111111111---------1-11111---11111111111111111112111111111111111111111111---112222222222222222111122222211211111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111111111122222221211-1-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111--11-11111111-1111-------------1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 52.5 SQ:SECSTR #################################################################################################################HHHHHHHHHHHHTTccEEEEEcccGGGGTTTEccEEEEEEccHHHHHHHTcTTcTTcccEEEEcTTccEEEEEEEEEcccTTccccccHHHHHHHHHHHHHccEEEEEccccccEEEEccccEEEEccHHHHHHHHHHHHHHHHHHHH##################### DISOP:02AL 97-112,255-269,271-283| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccHHEEEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEEcHHHHHHHHccccccccEEEEEEccEEEEEEEEEEccccccccHHHcHHHHHHHHHHHHcccEEEEEEccccEEEEEEccEEEEcccHHHHHHHHHHHHcccccccccccEEEEEccccccccccccc //