[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99958.1
DDBJ      :             ATP/GTP hydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  822/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:150 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->139 1htwA PDBj 2e-22 41.1 %
:RPS:PDB   12->136 2bjvA PDBj 7e-04 12.6 %
:RPS:SCOP  22->150 1fl9A  c.37.1.18 * 9e-12 36.5 %
:HMM:SCOP  22->152 1htwA_ c.37.1.18 * 2.3e-20 35.2 %
:RPS:PFM   11->122 PF02367 * UPF0079 1e-32 57.1 %
:HMM:PFM   11->129 PF02367 * UPF0079 5.6e-43 48.7 119/123  
:BLT:SWISS 9->150 YDIB_BACSU 6e-43 58.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99958.1 GT:GENE ABD99958.1 GT:PRODUCT ATP/GTP hydrolase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1183489..1183941) GB:FROM 1183489 GB:TO 1183941 GB:DIRECTION - GB:PRODUCT ATP/GTP hydrolase GB:NOTE COG0802 [R] Predicted ATPase or kinase GB:PROTEIN_ID ABD99958.1 GB:DB_XREF GI:90821319 LENGTH 150 SQ:AASEQ MEIISKKAEDTEKLAKKIAQFLKPQDIILLDGDLGAGKTTFTKGLALGLGIKKNVKSPTFTIVREYHEGRLPLYHMDVYRLEDASADDIGLDEYFNGDGVSVVEWSQFIDDELPNEYLIIHIIKDEQNDDQRKIVIEAKGERYQELLAEL GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 9->150|YDIB_BACSU|6e-43|58.3|139/158| BL:PDB:NREP 1 BL:PDB:REP 13->139|1htwA|2e-22|41.1|124/158| RP:PDB:NREP 1 RP:PDB:REP 12->136|2bjvA|7e-04|12.6|119/236| RP:PFM:NREP 1 RP:PFM:REP 11->122|PF02367|1e-32|57.1|112/123|UPF0079| HM:PFM:NREP 1 HM:PFM:REP 11->129|PF02367|5.6e-43|48.7|119/123|UPF0079| RP:SCP:NREP 1 RP:SCP:REP 22->150|1fl9A|9e-12|36.5|126/157|c.37.1.18| HM:SCP:REP 22->152|1htwA_|2.3e-20|35.2|128/158|c.37.1.18|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 830 OP:NHOMOORG 827 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-111111111111----111111111--1111-1-111111-111-11---1111111-1111111111111111111--1111111111111----1111111-111-111111111111111111111111111111111-111-111111111111111-111-1111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111-11111111111111111-11-11-1-111111111111111111111111111111111111111-11-11111111111111111111111111111----11111111111111111111111111111111111111111111111-1111111111-111111111111111111-11111-11--11-111111111111111-111111-111111---------1-11111111111111111111111111111111111--1-11-------11111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111--111---1-1------1--11---1-111111-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112-11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 85.3 SQ:SECSTR ###########HHHHHHHHHHTTccccEEEEccTTccHHHHHHHHHHTcTTTTcEEEEGGGccHHHHHHHHHcccccccHHHHTTTcEEEEEcGGGccHHHHHHHHHHHHHTccccccEEccccccEEcccEEEEEEEc########### PSIPRED cEEEEccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccccccEEEEEEEEccccEEEEEEEEEcccccHHHcccHHHcccccEEEEEcHHHHHcccccccEEEEEEEEcccccEEEEEEEEccHHHHHHHHHc //