[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99962.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.23.1
:179 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->158 2q4mA1 d.23.1.2 * 1.1e-08 20.6 %
:HMM:PFM   10->72 PF04525 * DUF567 4.3e-06 19.0 63/186  
:BLT:SWISS 6->154 YXJI_BACSU 2e-08 21.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99962.1 GT:GENE ABD99962.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1186698..1187237 GB:FROM 1186698 GB:TO 1187237 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABD99962.1 GB:DB_XREF GI:90821323 LENGTH 179 SQ:AASEQ MIQIRKLYTRRDMFEIGTQLTFRDSDKKIIYFLSGHLGGHQGRIDLFDIQGKLLAEARQKSLGFFPKFIFLEDGHYAGSLRRYYGINHDMLFVKKLNWFIFGNLFTFNYKVFKGRDCIMKIHEVTLPDGGNYLEFEISHKEYEPLCLCIASILDYWAKMRNPSRSKQTELNNNLNVNYS GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 6->154|YXJI_BACSU|2e-08|21.6|148/100| HM:PFM:NREP 1 HM:PFM:REP 10->72|PF04525|4.3e-06|19.0|63/186|DUF567| HM:SCP:REP 4->158|2q4mA1|1.1e-08|20.6|155/0|d.23.1.2|1/1|Tubby C-terminal domain-like| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-1---111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,178-180| PSIPRED ccHHHHHHHHHHHcccccEEEEEcccccEEEEEEEcccccccEEEEEEccccEEEEEEEEEEEEccEEEEEEccEEEEEEEEEccccccEEEEEcccEEEEEEEEEcEEEEEEccEEEEEEEEEEEEEccEEEEEEEccHHHccHHHHHHHHHHHHcccccccccccccccccEEEEEc //