[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99967.1
DDBJ      :             Multidrug resistance protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  111/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:393 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->362 1pw4A  f.38.1.1 * 3e-08 13.9 %
:HMM:SCOP  1->388 1pv7A_ f.38.1.2 * 2.9e-46 23.3 %
:RPS:PFM   276->362 PF07690 * MFS_1 1e-08 35.6 %
:HMM:PFM   10->291 PF07690 * MFS_1 1.2e-18 17.9 279/353  
:HMM:PFM   277->383 PF07690 * MFS_1 3.6e-19 33.6 107/353  
:BLT:SWISS 6->362 YTTB_BACSU 3e-45 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99967.1 GT:GENE ABD99967.1 GT:PRODUCT Multidrug resistance protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1192252..1193433) GB:FROM 1192252 GB:TO 1193433 GB:DIRECTION - GB:PRODUCT Multidrug resistance protein GB:NOTE COG0477 [GEPR] Permeases of the major facilitator superfamily GB:PROTEIN_ID ABD99967.1 GB:DB_XREF GI:90821328 LENGTH 393 SQ:AASEQ MKKEISLFAVLLGSFCTSFEMSFIWPLTSVYLHDNLHISLALVGLVLFFNSLASVIGNIFGGLGFDKLNPYYLLLLGGGVTTLSLVVLVFFHQALPFSICLFFLGLSAGWNGTLISALGAILKKYDGNYVFNMIYFIQNLGIVIGSSTVGFLYDWNIKLPFIAAMLISFGFLLVVMIGFRALKYENIHGSTHKHSKVKVVLPKINMYLIYSLFAMLLVTWTMYQQWGSNVSVYITSLGIPFRYYSVLWTINAGLILVIQIFIVRLRHLIKNNYIPIYFGIFTFALSFVVLFFAKQYYLFVVAMILLTFGEALAFPQVPVIINQLTPNEVKGKYLGLVNSFGSAGRAIAPLFGGLVIEGFGYRNLFLIAIIFNLAILIIVYLVRLRVGNNVKSY GT:EXON 1|1-393:0| BL:SWS:NREP 1 BL:SWS:REP 6->362|YTTB_BACSU|3e-45|31.2|352/397| TM:NTM 10 TM:REGION 6->28| TM:REGION 40->62| TM:REGION 79->101| TM:REGION 129->151| TM:REGION 159->181| TM:REGION 201->223| TM:REGION 248->270| TM:REGION 273->294| TM:REGION 303->325| TM:REGION 362->383| SEG 73->89|llllgggvttlslvvlv| SEG 363->378|nlfliaiifnlailii| RP:PFM:NREP 1 RP:PFM:REP 276->362|PF07690|1e-08|35.6|87/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 10->291|PF07690|1.2e-18|17.9|279/353|MFS_1| HM:PFM:REP 277->383|PF07690|3.6e-19|33.6|107/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 2->362|1pw4A|3e-08|13.9|360/434|f.38.1.1| HM:SCP:REP 1->388|1pv7A_|2.9e-46|23.3|387/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 147 OP:NHOMOORG 114 OP:PATTERN --------------------------------------------------------------33---- -------------------------------------------------------------------1-1-1---111---------------------------------------------------------------11-------------------------------------------------211111211211111111222121121112-221111114111111111111111111111-1312211212222232-11111--------------------------------------------------1--------1---------------1----11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------1--------------------------------------------------------1------------------------------------------------------------------------------------11-1---1-1-1-------------------11111--1--------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,182-200,390-394| PSIPRED cccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //