[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99975.1
DDBJ      :             Central glycolytic genes regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.124.1
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   96->341 2o0mA PDBj 7e-57 49.4 %
:RPS:PDB   91->341 3bxeB PDBj 1e-30 45.6 %
:RPS:SCOP  24->79 2p8tA1  a.4.5.72 * 1e-05 29.6 %
:RPS:SCOP  95->341 2o0mA1  c.124.1.8 * 6e-65 52.6 %
:HMM:SCOP  13->86 1in4A1 a.4.5.11 * 6.2e-05 25.7 %
:RPS:PFM   33->84 PF03444 * DUF293 7e-04 38.5 %
:RPS:PFM   93->340 PF04198 * Sugar-bind 4e-29 37.0 %
:HMM:PFM   92->341 PF04198 * Sugar-bind 3.7e-65 37.1 245/255  
:HMM:PFM   33->80 PF05491 * RuvB_C 0.00038 31.2 48/76  
:BLT:SWISS 1->341 CGGR_BACSU 8e-73 42.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99975.1 GT:GENE ABD99975.1 GT:PRODUCT Central glycolytic genes regulator GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1201618..1202646) GB:FROM 1201618 GB:TO 1202646 GB:DIRECTION - GB:PRODUCT Central glycolytic genes regulator GB:NOTE COG2390 [K] Transcriptional regulator, contains sigma factor-related N-terminal domain GB:PROTEIN_ID ABD99975.1 GB:DB_XREF GI:90821336 LENGTH 342 SQ:AASEQ MREEVELIESIVPDLIDVLRKRFIILRNIDWSEPVGRRVLAQTLGMSERVLRTETDYLRKQELIASTKSGMILTAKGKRTIQGLSKLMDSLLGLQQMEKELSRYLGIRNCLIVSGDSDRQPLIIEDMGKLVNDILGKELPKGKNVIAAMGGTTMAKVATCLTPEIAVDRDLTFVPARGGIGERLDIQANNVCGLMAEKTGGNHRTLYVPEQVSEDTYRPLLNEPVVQEVVNLIRQSNAAVHSIGEAISMAERRSMPKNVLAMLKERKAVSETFGYFFDDKGKVVYKIPRIGLQLEDLANMDCIIAVAGGSSKARAIAAYMKNAPEKTYLITDEGAAKMILKG GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 1->341|CGGR_BACSU|8e-73|42.3|338/340| BL:PDB:NREP 1 BL:PDB:REP 96->341|2o0mA|7e-57|49.4|235/236| RP:PDB:NREP 1 RP:PDB:REP 91->341|3bxeB|1e-30|45.6|248/253| RP:PFM:NREP 2 RP:PFM:REP 33->84|PF03444|7e-04|38.5|52/76|DUF293| RP:PFM:REP 93->340|PF04198|4e-29|37.0|243/254|Sugar-bind| HM:PFM:NREP 2 HM:PFM:REP 92->341|PF04198|3.7e-65|37.1|245/255|Sugar-bind| HM:PFM:REP 33->80|PF05491|0.00038|31.2|48/76|RuvB_C| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF03444|IPR005104| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03444|IPR005104| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF04198|IPR007324| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF04198|IPR007324| RP:SCP:NREP 2 RP:SCP:REP 24->79|2p8tA1|1e-05|29.6|54/67|a.4.5.72| RP:SCP:REP 95->341|2o0mA1|6e-65|52.6|247/247|c.124.1.8| HM:SCP:REP 13->86|1in4A1|6.2e-05|25.7|74/75|a.4.5.11|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 205 OP:NHOMOORG 171 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122111111112111111111131111111111112222111111111111111111111111111111111111--11111--------------------------------------------------111111111111111-2--1111-1-----------1-111--1111------------------------------12-211-13----------1--222-21122132-------------1----------------------------------------------------------------1111----1111--------------1----1----2------------------------------------------------------------------------------------------------------------------------------1---------------------------------11111-------------------------------22222212222----------------1----1----------1-------------------------------------------1111111111------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 73.4 SQ:SECSTR ##########################################################################################HTTHHHHHHHHHHHHTccEEEEEcccTTTcTHHHHHHHHHHHHHHHHHcccEcEEEEEcccHHHHHHHHHcHcccTTccEEEEEEccccTTccGGGcHHHHHHHHHHHHTcEEccccccTTccHHHHHHHHTcHHHHHHHHHHHTccEEEEccEEHHHHHHHTTccHHHHHHHHHTTccEEETTEEEcTTccEEEEcccccccGGGGGGccEEEEEcccGGGHHHHHHHTTccccEEEEEEEHHHHHHHHc# DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHcccccccccccEEEEccccccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcHHHHHHHHHHHHccEEEEEcccHHHHHHHccccHHHHHHHHHcccEEEEEEccccccccEEccccEEcccHHHHHccccEEEEEccccHHHHHHHHHHccccccEEEccHHHHHHHHcc //