[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABD99998.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   11->122 3dtiA PDBj 2e-07 17.4 %
:HMM:PFM   27->114 PF06114 * DUF955 4.4e-12 26.4 87/122  
:BLT:SWISS 7->117 YIM2_BPPH1 7e-08 27.3 %
:PROS 66->75|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABD99998.1 GT:GENE ABD99998.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1229718..1230119) GB:FROM 1229718 GB:TO 1230119 GB:DIRECTION - GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABD99998.1 GB:DB_XREF GI:90821359 LENGTH 133 SQ:AASEQ MTTQKTINNLYHEFNTYDVKRILKMKNIPVLYYPLGNVTLGYTATIKRIKTITVDNSLNEIQTDFILGHELSHVLNNDIGTPYYRRVGSFSAISKKEKQANNLSLGLLACRYELDKYSRDMQIKQLGLSDFLD GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 7->117|YIM2_BPPH1|7e-08|27.3|110/158| PROS 66->75|PS00142|ZINC_PROTEASE|PDOC00129| RP:PDB:NREP 1 RP:PDB:REP 11->122|3dtiA|2e-07|17.4|109/243| HM:PFM:NREP 1 HM:PFM:REP 27->114|PF06114|4.4e-12|26.4|87/122|DUF955| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12-----------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 83.5 SQ:SECSTR ##########HHHTcccHHHHHHTcTTcEEEEEccTTccEEE#EEETTTTEEEEEccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccTHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHc########### PSIPRED ccHHHHHHHHHHHcccccHHHHHHHcccEEEEEcccccHHHEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHccccccHHHccHHHHcc //