[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00002.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.16.1
:112 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  18->79 1kdgA2  d.16.1.1 * 5e-04 3.6 %
:HMM:PFM   63->91 PF07471 * Phage_Nu1 0.00015 44.8 29/164  
:HMM:PFM   10->49 PF01519 * DUF16 0.00094 25.6 39/102  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00002.1 GT:GENE ABE00002.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1231367..1231705 GB:FROM 1231367 GB:TO 1231705 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00002.1 GB:DB_XREF GI:90821363 LENGTH 112 SQ:AASEQ MKKLENRPYQKQQPSQMPIVAVYFTDKQFEEIKQGVIDGTIDKLIREIARDEIKKYDLKAPYLNQKEFSEWIGESVATIKQLKAKGLPVSKALNTDRYGKQSYIDFMRQHER GT:EXON 1|1-112:0| HM:PFM:NREP 2 HM:PFM:REP 63->91|PF07471|0.00015|44.8|29/164|Phage_Nu1| HM:PFM:REP 10->49|PF01519|0.00094|25.6|39/102|DUF16| RP:SCP:NREP 1 RP:SCP:REP 18->79|1kdgA2|5e-04|3.6|56/181|d.16.1.1| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,110-113| PSIPRED ccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHcc //