[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00009.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
d.264.1
:256 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->111 1rniA  d.264.1.2 * 5e-11 23.8 %
:HMM:SCOP  1->187 1ro2A_ d.264.1.2 * 1.3e-22 28.6 %
:RPS:PFM   8->155 PF09250 * Prim-Pol 2e-17 36.3 %
:HMM:PFM   11->158 PF09250 * Prim-Pol 6e-30 35.2 145/162  
:HMM:PFM   190->253 PF08708 * PriCT_1 1.2e-14 25.4 63/72  
:BLT:SWISS 137->255 E13D_TOBAC 4e-04 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00009.1 GT:GENE ABE00009.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1233402..1234172 GB:FROM 1233402 GB:TO 1234172 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABE00009.1 GB:DB_XREF GI:90821370 LENGTH 256 SQ:AASEQ MDRLNQVIKMVQRGLYVYPIVPNGKQPIKDYSYLKASQDIALIKRWFMDEPNINIGLNLAKSNLIVVDIDNHNNDLQAPLQSLSNLGYNLPSDYVERTQSGGLHYYFRSNKPVKPTRKTKFIDGVDLLSDFVVSSPSNNYKVLNGATLDDIPQAPNWIIKALDNRAMPTDKMEDNHYSYKKYYTGYLLDEIVKGVDSGNRNNWIASIFGKLLRAGTEPKNAYNLIQLINDNYVSPPLETKELDTVVTSILKRFINE GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 137->255|E13D_TOBAC|4e-04|29.7|111/351| RP:PFM:NREP 1 RP:PFM:REP 8->155|PF09250|2e-17|36.3|146/163|Prim-Pol| HM:PFM:NREP 2 HM:PFM:REP 11->158|PF09250|6e-30|35.2|145/162|Prim-Pol| HM:PFM:REP 190->253|PF08708|1.2e-14|25.4|63/72|PriCT_1| RP:SCP:NREP 1 RP:SCP:REP 2->111|1rniA|5e-11|23.8|105/210|d.264.1.2| HM:SCP:REP 1->187|1ro2A_|1.3e-22|28.6|185/210|d.264.1.2|1/1|Prim-pol domain| OP:NHOMO 48 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---22--1212-1--113-----1-----------------22---22-1------------1------------------------8---------------------------------------------------------------1----1--------------------------------------------1-------------------------------------------11------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------1-------------------------------------------1111------------------------------------------ DISOP:02AL 1-1,167-181,255-257| PSIPRED ccHHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHcccccEEEEcccccEEEEEEcccccHHHHHHHHHHHccccccccEEEEcccccEEEEEEccccccccccccccccEEEcccEEEcccccccEEcccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc //