[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00015.1
DDBJ      :             ComF operon protein 1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  134/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:445 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   347->426 2nmvA PDBj 3e-06 35.1 %
:RPS:PDB   110->407 1cu1A PDBj 3e-10 14.3 %
:RPS:SCOP  98->246 2eyqA3  c.37.1.19 * 8e-11 25.2 %
:RPS:SCOP  307->433 2eyqA5  c.37.1.19 * 3e-13 22.0 %
:HMM:SCOP  110->425 2bmfA2 c.37.1.14 * 1e-33 23.1 %
:RPS:PFM   328->404 PF00271 * Helicase_C 8e-06 31.0 %
:HMM:PFM   98->246 PF04851 * ResIII 1.8e-12 30.0 140/184  
:HMM:PFM   346->403 PF00271 * Helicase_C 5.2e-10 26.8 56/78  
:HMM:PFM   39->66 PF06827 * zf-FPG_IleRS 2.9e-06 25.9 27/30  
:BLT:SWISS 14->440 COMFA_BACSU 2e-85 42.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00015.1 GT:GENE ABE00015.1 GT:PRODUCT ComF operon protein 1 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1239115..1240452) GB:FROM 1239115 GB:TO 1240452 GB:DIRECTION - GB:PRODUCT ComF operon protein 1 GB:NOTE COG4098 [L] Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) GB:PROTEIN_ID ABE00015.1 GB:DB_XREF GI:90821376 LENGTH 445 SQ:AASEQ MDFNEMAGRLVVVDKSEEKIMSSDNIEVYQAVKVFKNKIKCNRCGKVTTKERAKLPYDNYYCPKCIVLGRVSTLNNLVHVIEDNHFNNVDEILTWDGKLSKFQEVCSNELINIIEKNTEHLLWAVTGAGKTEMLFKPIAEALRKKFRVAIASPRVDVCNELYPRLDKAFKEIDKILLHGRSEEVYRYTQLVVCTTHQLLKFKEAFDVLIIDEVDAFPYVNNKELLFATKQAIKKTGTLIYLTATPSNELAKKIKRGNISISYLPMRFHQNALPTIKVEFTNNWWGFILQGKLDTKIKKYLKKWEQNGKQFLVFVPHVAMLNKVREVIKAVLASKIKGDTVHAADEYRIEKVQKMRNKEYTYLITTTILERGVTFPEIDLLVLGADNSVFSTSALVQIAGRVGRSVSRPDGDVIFICDRYTRKVKDAQKQIEFLNKKAKKLREGIS GT:EXON 1|1-445:0| BL:SWS:NREP 1 BL:SWS:REP 14->440|COMFA_BACSU|2e-85|42.9|422/463| SEG 291->302|kldtkikkylkk| BL:PDB:NREP 1 BL:PDB:REP 347->426|2nmvA|3e-06|35.1|77/620| RP:PDB:NREP 1 RP:PDB:REP 110->407|1cu1A|3e-10|14.3|265/645| RP:PFM:NREP 1 RP:PFM:REP 328->404|PF00271|8e-06|31.0|71/76|Helicase_C| HM:PFM:NREP 3 HM:PFM:REP 98->246|PF04851|1.8e-12|30.0|140/184|ResIII| HM:PFM:REP 346->403|PF00271|5.2e-10|26.8|56/78|Helicase_C| HM:PFM:REP 39->66|PF06827|2.9e-06|25.9|27/30|zf-FPG_IleRS| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00271|IPR001650| GO:PFM GO:0004386|"GO:helicase activity"|PF00271|IPR001650| GO:PFM GO:0005524|"GO:ATP binding"|PF00271|IPR001650| RP:SCP:NREP 2 RP:SCP:REP 98->246|2eyqA3|8e-11|25.2|143/233|c.37.1.19| RP:SCP:REP 307->433|2eyqA5|3e-13|22.0|123/211|c.37.1.19| HM:SCP:REP 110->425|2bmfA2|1e-33|23.1|273/0|c.37.1.14|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 135 OP:NHOMOORG 134 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111111111111111111111111111111111-111111111111111-1-111111-11111111111111111211111111111111111111-------------------------------1-11-----1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 339 STR:RPRED 76.2 SQ:SECSTR #################################################################################################cccHHHH####cccccccccEEEEEEccccccTTTHHHHHHcccHTTTccEEEEEccHHHHHHHHHHHHHHTccccEEEcccccccEEccccEEEEEHHHHHccTTcccEEEEETTTcccHHHHHHHHHHHHHTTTTTccEEEEEEEcccTTccccccTTEEEEEccccccEEEEEEcEETTEEEcGGHHHHHHHHHHHT####EHGTcccEEEEEccccHHHHHHHHHHHHccEEEEcTTccccccccccccccEEEEEcTTHHHHccccccEEEEccEEEEEEEcccccccEEEEEEEccHHHHHHHHTTcEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHT# DISOP:02AL 1-3,181-184,423-437,445-446| PSIPRED cccHHHccHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEcccccccccccccccccHHHHHHHcccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHcccEEEEccHHHHcHHHHccEEEEEcHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHcccEEEEEEcccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHcccccEEEEHHHHHHccccccccEEEEccccccccHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccc //