[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00028.1
DDBJ      :             Acyl-acyl carrier protein thioesterase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  120/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->244 2ownA PDBj 2e-47 40.3 %
:RPS:PDB   4->136 3ck1A PDBj 1e-09 8.3 %
:RPS:PDB   158->245 2egiH PDBj 2e-09 19.3 %
:RPS:SCOP  6->138 2essA1  d.38.1.8 * 5e-30 16.7 %
:RPS:SCOP  158->244 2essA2  d.38.1.8 * 6e-13 22.4 %
:HMM:SCOP  1->147 2essA1 d.38.1.8 * 3e-33 27.9 %
:HMM:SCOP  146->245 2essA2 d.38.1.8 * 6.9e-23 25.5 %
:RPS:PFM   6->233 PF01643 * Acyl-ACP_TE 8e-34 33.5 %
:HMM:PFM   4->244 PF01643 * Acyl-ACP_TE 4.8e-65 31.7 240/249  
:BLT:SWISS 6->226 FATA_CORSA 7e-15 27.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00028.1 GT:GENE ABE00028.1 GT:PRODUCT Acyl-acyl carrier protein thioesterase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1255572..1256309) GB:FROM 1255572 GB:TO 1256309 GB:DIRECTION - GB:PRODUCT Acyl-acyl carrier protein thioesterase GB:NOTE COG3884 [I] Acyl-ACP thioesterase GB:PROTEIN_ID ABE00028.1 GB:DB_XREF GI:90821389 LENGTH 245 SQ:AASEQ MVAKRYNEKHRVVFYETDVTKNINIGMLVDLMMLASENQSEQLGIGTDKVNGLGYGWVITQHVLEIERLPKINEEVKIWTEADSYNKYFCYREFGIDDMDDNPLVRMHTIFVLMDFKNRKISQIVPELIIPFGATETPKVKRYKNVKKIKEIDNHKKYQVRFMDIDSNHHVNNVHYFDWMLDTLDYDFLSKHTLKKINIQYKQEVTYGDIVTSNVQIINSNDTITTLHAVKNNDKVSCLAECEWI GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 6->226|FATA_CORSA|7e-15|27.1|218/369| SEG 139->150|kvkryknvkkik| BL:PDB:NREP 1 BL:PDB:REP 3->244|2ownA|2e-47|40.3|238/252| RP:PDB:NREP 2 RP:PDB:REP 4->136|3ck1A|1e-09|8.3|132/138| RP:PDB:REP 158->245|2egiH|2e-09|19.3|88/97| RP:PFM:NREP 1 RP:PFM:REP 6->233|PF01643|8e-34|33.5|224/229|Acyl-ACP_TE| HM:PFM:NREP 1 HM:PFM:REP 4->244|PF01643|4.8e-65|31.7|240/249|Acyl-ACP_TE| RP:SCP:NREP 2 RP:SCP:REP 6->138|2essA1|5e-30|16.7|132/145|d.38.1.8| RP:SCP:REP 158->244|2essA2|6e-13|22.4|85/98|d.38.1.8| HM:SCP:REP 1->147|2essA1|3e-33|27.9|147/0|d.38.1.8|1/2|Thioesterase/thiol ester dehydrase-isomerase| HM:SCP:REP 146->245|2essA2|6.9e-23|25.5|98/0|d.38.1.8|2/2|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 156 OP:NHOMOORG 128 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1---------11-1-1------11----------------------------------------------------------------------------------------1--------------------------------------------------------------1111111111111111111111111111111111111111111111111111111111111211111111--11211111111111-11122-11111-11--11------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---11--------1--1----1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7111--7--9-33------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 243 STR:RPRED 99.2 SQ:SECSTR ##GccEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTccccHHHHTTTcEEccEEEEEEEEcccccTTcEEEEEEEEEEEcccEEEEEEEEcTTTccEEEEEEEEEEcEEETTEEEccccHHHHHHHTTccHHHHHHHHHHHHHHHHHHccEEEccGGGccTTccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEcccccTTcEEEEEEEEEEEccccEEEEEEEETTEEEEEEEEEEE DISOP:02AL 1-3| PSIPRED cccccEEEEEEEEEEEEccccEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEEEEEEEcccccEEEccHHHHHHHccccHHHHHHHHHHHHHccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEc //